Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate PfGW456L13_3699 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3699 Length = 258 Score = 177 bits (448), Expect = 3e-49 Identities = 99/251 (39%), Positives = 142/251 (56%), Gaps = 7/251 (2%) Query: 13 LPLCA---TAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLEVKCTWV 69 L LCA AHA E +R G+ YPPF +G++ GFD ++GNA+C +++VKC WV Sbjct: 10 LALCAFSFLAHADE-DSLRIGIEAAYPPFSFKTPEGNVSGFDYDIGNALCEEMKVKCEWV 68 Query: 70 HNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADFGDTPES 129 EFDGMIP+L+ RK DA++SSM++T R K +DFS + + +P + D Sbjct: 69 IQEFDGMIPSLKVRKIDAVLSSMSITEDRMKSVDFSKKYYHTPGKFAMKAGNVINDPLVD 128 Query: 130 LMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDKLEAQLN 189 L GK+VGV + S + +A L K G + Y SQ++ + DL +GRLDATL D + + Sbjct: 129 LKGKKVGVQRSSTYDRFATEQLEKAGVVVVRYSSQNEAFLDLASGRLDATLADIVNTDES 188 Query: 190 FLSKPEGSDFK-TGPAFKDPT-LPLDIAMGLRKNDQALRALINKGIAAVQADGTYAQIQK 247 F+ G F TGP DP + +RK D A A ++ I A++A+G Y Q+ Sbjct: 189 FIKTAAGQGFALTGPDINDPKYFGRGAGIAVRKGDSANVARLSAAIDAIRANGKYQQVMA 248 Query: 248 KYFGDQDIYHE 258 +YF DIY E Sbjct: 249 RYFA-FDIYGE 258 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory