GapMind for catabolism of small carbon sources

 

Aligments for a candidate for H281DRAFT_01113 in Pseudomonas fluorescens GW456-L13

Align deoxynucleoside transporter, ATPase component (characterized)
to candidate PfGW456L13_2121 L-arabinose transport ATP-binding protein AraG (TC 3.A.1.2.2)

Query= reanno::Burk376:H281DRAFT_01113
         (515 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2121 L-arabinose
           transport ATP-binding protein AraG (TC 3.A.1.2.2)
          Length = 514

 Score =  288 bits (737), Expect = 3e-82
 Identities = 179/497 (36%), Positives = 279/497 (56%), Gaps = 17/497 (3%)

Query: 20  GVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPPDEGQLVIEGVPH 79
           G+ K F GV AL  +S     GQ++ L+GENG GKSTL+KI+ GA  P  G L I     
Sbjct: 20  GIGKTFPGVKALDNISFVAHPGQVHALMGENGAGKSTLLKILGGAYTPCSGALQIGERTM 79

Query: 80  ARLSALEALAAGIETVYQDLSLLPNMSVAENVALTSELATHEGRLARTF---DRRVLAAT 136
              S  +++ +G+  ++Q+L L+P M+VAEN+ L        G L  +F   +R  L   
Sbjct: 80  DFKSTADSIGSGVAVIHQELHLVPEMTVAENLFL--------GHLPASFGLINRSTLRQQ 131

Query: 137 AARALEAVGLPGNSEFQSTLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLTQKEVD 196
           A   L+  GL    + Q   + +L L  RQLV IA+A++  A  +  DEPT+SL+ +E+D
Sbjct: 132 ALACLK--GLADEIDPQEK-VGRLSLGQRQLVEIAKALSRGAHVIAFDEPTSSLSAREID 188

Query: 197 NLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQ-GPIAEFTKAQISELM 255
            L+A++  LR +G  VL+VSH+++E + I   V V +DG+ +     +++ T  Q+   M
Sbjct: 189 RLMAIIGRLRDEGKVVLYVSHRMEEVFRICNAVTVFKDGRYVRTFDDMSQLTHDQLVTCM 248

Query: 256 TGRHLSNERYRESAHAQDIVLDVRGFTRAGQFSDVSFKLHGGEILGVTGLLDSGRNELAR 315
            GR + +           + L V G    G    VSF++H GEILG+ GL+ +GR EL R
Sbjct: 249 VGRDIQDIYDYRPRQRGAVALKVDGLLGPGLREPVSFEVHKGEILGLFGLVGAGRTELLR 308

Query: 316 ALAGVAPAQSGDVLLDGQQIALRTPSDAKRHRIGYVPEDRLNEGLFLDKPIRDNVITAMI 375
            L+G+A   +G + L G ++ LR+P DA    I   PEDR  EG+     + +N I    
Sbjct: 309 LLSGLARHSAGQLKLRGHELKLRSPRDAIAAGILLCPEDRKKEGILPLASVAEN-INISA 367

Query: 376 SSLRDRFGQIDRTRAQA-LAEQTVKELQIATPGVDKPVQSLSGGNQQRVLIGRWLAIDPR 434
                 FG + R   +   AEQ +K L++ TP   + +  LSGGNQQ+ ++GRWL++  +
Sbjct: 368 RGAHSTFGCLLRGLWEKDNAEQQIKALKVKTPNAAQKIMYLSGGNQQKAILGRWLSMPMK 427

Query: 435 VLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGHVSA 494
           VL+L  PT G+D+G+K  IY+I+  L+  GI +I++S DL E++   DRIL++ +G +  
Sbjct: 428 VLLLDEPTRGIDIGAKAEIYQIIHNLAAEGIAVIVVSSDLMEVMGISDRILVLCEGALRG 487

Query: 495 EYRADELSEADLYHALL 511
           E   ++ +E++L    L
Sbjct: 488 ELSREQANESNLLQLAL 504


Lambda     K      H
   0.319    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 599
Number of extensions: 33
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 515
Length of database: 514
Length adjustment: 35
Effective length of query: 480
Effective length of database: 479
Effective search space:   229920
Effective search space used:   229920
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory