Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate PfGW456L13_3458 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3458 Length = 251 Score = 119 bits (298), Expect = 6e-32 Identities = 85/252 (33%), Positives = 131/252 (51%), Gaps = 7/252 (2%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPGTVATRADVSDAAQ 71 G R++++GGA GIG + A++E GA V D+ E+A ++ D + D++D+ Sbjct: 5 GKRIIVTGGARGIGAAVVKAFVEEGAHVVSLDLGEAA-SITGDGGGWAHSRVCDIADSQS 63 Query: 72 IEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVPM 131 ++A F E L GLDVLV+ AGIA P D+I+ EW+ +N + A + Sbjct: 64 VDAAFAWASEQLNGLDVLVHAAGIA-PNASADSITLDEWEKVFAVNTRGTFLTNRAAYEL 122 Query: 132 LKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGIV 191 LK S G +++ AS AG LG + YAA+K A++ +++A E G I VNA+ P + Sbjct: 123 LKGSG-GRIINFASAAGVLGQPGKAHYAASKGAVLAWTRTVAREWGPLGITVNAIAPAMW 181 Query: 192 EGPRMDGV-IRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVTG 250 P D AEQ+ +A M + I K A D+A + +FL +R VTG Sbjct: 182 T-PMYDATRASMSAEQLQQHDAYMAGQV--PIGGKLGEPARDLAPVLVFLAGDGSRFVTG 238 Query: 251 QAISVDGNVEYL 262 Q + +DG + L Sbjct: 239 QTLVIDGGMMML 250 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 251 Length adjustment: 24 Effective length of query: 238 Effective length of database: 227 Effective search space: 54026 Effective search space used: 54026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory