Align Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 (characterized)
to candidate PfGW456L13_3925 Putative diheme cytochrome c-553
Query= SwissProt::Q47945 (478 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3925 Length = 412 Score = 250 bits (638), Expect = 7e-71 Identities = 159/424 (37%), Positives = 226/424 (53%), Gaps = 25/424 (5%) Query: 19 KLAAAIGLMAVSFGAAHAQDADEALIKRGEYVARLSDCIACHTALHGQPYAGGLEIKSPI 78 +LA A+GL A AAHA DA +K+GEY+AR +DC+ACHTA G PYAGGL I SP Sbjct: 7 RLALAVGL-AAPVVAAHADDAQ---VKQGEYLARAADCMACHTAPGGAPYAGGLPIVSPF 62 Query: 79 GTIYSTNITPDPEHGIGNYTLEDFTKALRKGIRKDGATVYPAMPYPEFARLSDDDIRAMY 138 GTIY TNITP EHGIG Y ++F AL +G R+DGA +YPAMPY + + D A++ Sbjct: 63 GTIYGTNITPSKEHGIGLYNDDEFFAALTEGKRRDGANLYPAMPYTSYHLIPRADSDAIH 122 Query: 139 AFFMHGVKPVALQNKAPDISWPLSMRWPLGMWRAMFVP--SMTPGVDKSISDPEVARGEY 196 A ++ V+P+ +S+P ++R L W M+ + P KS RG+Y Sbjct: 123 A-YLKTVEPIERAAPVTSLSFPFNVRLGLMGWNMMYGKDVKLEPAEGKS---EAWKRGQY 178 Query: 197 LVNGPGHCGECHTPRGFGMQVKAYGTAGGNAYLAGGAPIDNWIAPSLRSNSDTGLGRWSE 256 +V+ GHCGECHTPRG G + + GG ++ ++APSL + +D W+ Sbjct: 179 MVDVLGHCGECHTPRGLP------GAMQMDKRMTGGI-LNGYLAPSLLA-TDLAARGWNH 230 Query: 257 DDIVTFLKSGRIDHSAVFGGMADVVAYSTQHWSDDDLRATAKYLKSMPAVPEGKNLGQDD 316 D+ +FLK G +F M V STQ SD DL A A +L P K L + Sbjct: 231 QDLSSFLKHGMSAQGTMFNEMFPVFHNSTQGLSDPDLAAMATFLLG-DQPPAAKVLVE-- 287 Query: 317 GQTTALLNKGGQGNAGAEVYLHNCAICHMNDGTGVNRMFPPLAGNPVVITDDPTSLANVV 376 L G + YL+ CA CH G G + + GN + +DP +L V+ Sbjct: 288 ---VPLDKLSPSVQRGRQEYLNVCAGCHAPGGEGKPHIAVAMRGNTTLRLEDPRNLVRVI 344 Query: 377 AFGGILPPTNSAPSAVAMPGFKNHLSDQEMADVVNFMRKGWGNNAPGTVSASDIQKLRTT 436 G + MPGF + L+D+++ D++N++R+GWG P ++ +D+QKLR Sbjct: 345 DDGIGEQKFSGFEHMQPMPGFVDKLNDEQLTDLLNYLRQGWGGQ-PNDLAVNDVQKLRAD 403 Query: 437 GAPV 440 P+ Sbjct: 404 APPL 407 Lambda K H 0.317 0.134 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 685 Number of extensions: 40 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 478 Length of database: 412 Length adjustment: 32 Effective length of query: 446 Effective length of database: 380 Effective search space: 169480 Effective search space used: 169480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory