Align 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) protein; EC 4.2.1.80 (characterized, see rationale)
to candidate PfGW456L13_3405 Fumarylacetoacetate hydrolase family protein
Query= uniprot:D8INW0 (281 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3405 Length = 332 Score = 114 bits (286), Expect = 2e-30 Identities = 67/182 (36%), Positives = 104/182 (57%), Gaps = 5/182 (2%) Query: 94 EPVVFNKWTSAVVGPNDNVKIPRGSKKTDWEVELGVIIGKGGSYIDEKDAMSHVAGYCVV 153 +P+ + AV+G +D + P S+ D+E+E G IGK G I + A SH+ GY + Sbjct: 140 QPIYYKGNRFAVIGIDDEFQWPSFSRAMDFELEFGCYIGKRGKDISRETARSHIVGYTIF 199 Query: 154 NDVSEREYQ-IERGGTWD--KGKGCDTFGPIGPWLVTRDEVADPQKLGMWLEVDGKRYQN 210 ND+S R+ Q +E G K K DT +GP LVT DE+ DP L M V+G+ + Sbjct: 200 NDMSARDAQALEMPGMLGPAKSKDFDTANIMGPCLVTADELGDPYDLNMVARVNGEEWGR 259 Query: 211 GNTSTMIFNVAHIVSYLSRFMSLQPGDVISTGTPPGVGMGVKPEAVYLRAGQTIRLGIDG 270 GNT M ++ +++++SR +L PG+ + +GT G G G++ + YL+ G + L IDG Sbjct: 260 GNTRDMRWSFEDVIAHVSRSETLYPGEFLGSGT-VGNGCGLE-QLRYLKPGDVVELEIDG 317 Query: 271 LG 272 +G Sbjct: 318 IG 319 Lambda K H 0.316 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 332 Length adjustment: 27 Effective length of query: 254 Effective length of database: 305 Effective search space: 77470 Effective search space used: 77470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory