Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate PfGW456L13_1569 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1569 Length = 372 Score = 240 bits (613), Expect = 4e-68 Identities = 133/293 (45%), Positives = 184/293 (62%), Gaps = 13/293 (4%) Query: 4 VTLKKLVKRYGALEV----VHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGA 59 V+++ + K YG + + IDL+++D EF L+GPSGCGK+T LRMIAG E + G Sbjct: 12 VSIRSVRKVYGDPKTGPVALKSIDLDIRDNEFFTLLGPSGCGKTTLLRMIAGFEFPTEGE 71 Query: 60 IEIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKI--AGRPAE--EIKTRVA 115 I + G + D PP R ++ VFQ YAL+PHMT+AEN+ F L+ G+ ++ RV Sbjct: 72 ILLYGENIADRPPFQRPVNTVFQHYALFPHMTIAENLAFGLESHPMGKVLHKTQLAERVR 131 Query: 116 EAAAILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTE 175 E A++ + R+P+QLSGGQ+QRVA+ RA+ P V L DEPLS LD KLR +R E Sbjct: 132 EMLALVQMERFANRKPAQLSGGQQQRVALARALAPHPKVLLLDEPLSALDLKLRQAMREE 191 Query: 176 IKKLHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIG 235 +K + AR T I+VTHDQ EA+T+SDRI ++ +G ++QVG PED++ RP +FVA FIG Sbjct: 192 LKTIQARTGITFIFVTHDQEEALTMSDRIAVLSEGEVQQVGRPEDIYERPRNRFVADFIG 251 Query: 236 SPPMNMEEAVLT---DGKLAFASGATLPLPPRFRSLVREGQKVTFGLRPDDVY 285 N E +T DG FA A PLP + S VR G VT +RP+ ++ Sbjct: 252 E--TNFIEGTVTRVEDGLAWFAGPAGHPLPAQPCSDVRVGANVTLSVRPERLH 302 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 372 Length adjustment: 30 Effective length of query: 335 Effective length of database: 342 Effective search space: 114570 Effective search space used: 114570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory