Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate PfGW456L13_2200 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)
Query= BRENDA::P9WN67 (314 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2200 Length = 333 Score = 123 bits (309), Expect = 5e-33 Identities = 94/308 (30%), Positives = 146/308 (47%), Gaps = 31/308 (10%) Query: 27 VVGLDNFA-TGRATNLEHLADNSAHVFVEADIVT-ADLHAILEQHRPEVVFHLAAQIDVR 84 V+ LD G +L +A+++ + FV+ADIV A + A+L + +P + HLAA+ V Sbjct: 1 VLNLDKLTYAGNLESLTSIANDTRYEFVQADIVDQATVSAVLARFQPHAIMHLAAESHVD 60 Query: 85 RSVADPQFDAAVNVIGTVRLAEAAR---------QTGVRKIVHTSSG---GSIYGTPPEY 132 RS+ P N++GT L EAAR + + H S+ G ++G + Sbjct: 61 RSIDGPSEFIQTNIVGTYSLLEAARAYWQALPEPEKSAFRFHHISTDEVYGDLHGVDDLF 120 Query: 133 PTPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAPANVYGPRQDPHGEAGVVAI 192 ET P P+SPY+A K A + + ++ YGL +N YGP P +V + Sbjct: 121 --TETTPYAPSSPYSASKAASDHLVRAWQRTYGLPVLLTNCSNNYGPFHFPEKLIPLVIL 178 Query: 193 FAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSADVGGGLRFNIGTGKETSDRQLH 252 A L+GKP V+G+G RD++FV+D A ++V G +NIG E + + Sbjct: 179 NA---LAGKPLPVYGNGLQVRDWLFVEDHARALLKVVTTGTVGETYNIGGHNEQKNIDVV 235 Query: 253 SAVAAAVG--GPDDPE----------FHPPRLGDLKRSCLDIGLAERVLGWRPQIELADG 300 + A + P PE F R G R +D ER LGW P+ G Sbjct: 236 RGICALLEELAPHKPEGVAHYADLITFVQDRPGHDLRYAIDASKIERELGWVPEETFETG 295 Query: 301 VRRTVEYF 308 +R+TV+++ Sbjct: 296 LRKTVQWY 303 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 333 Length adjustment: 28 Effective length of query: 286 Effective length of database: 305 Effective search space: 87230 Effective search space used: 87230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory