Align Phthalate permease of the major facilitator superfamily protein (characterized, see rationale)
to candidate PfGW456L13_2130 Hexuronate transporter
Query= uniprot:D8IX31 (418 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2130 Length = 436 Score = 186 bits (473), Expect = 9e-52 Identities = 115/403 (28%), Positives = 189/403 (46%), Gaps = 11/403 (2%) Query: 8 RWYMVTLVTLALIVNYLARNTLSVAAPTMMKELDMSTQQYSYIVVAWQICYAVMQPVAGY 67 R++++ L+ + +++NYL R+ LS+AAP + +L + I A+ YA MQ G+ Sbjct: 19 RFFIMVLLFITVVINYLDRSNLSIAAPALTSDLGIDPIHVGLIFSAFGWTYAAMQIPGGW 78 Query: 68 ILDAVGTKIGFGIFALAWSLVCAAAAFATGWQSLAFFRALLGITEAAGIPGGVKASTEWF 127 ++D V +I + + L WS+ FA + +L R +G EA P + T WF Sbjct: 79 LVDRVPPRILYSVALLLWSVATVMLGFAGSFIALFVLRMAVGALEAPAYPINSRVVTTWF 138 Query: 128 PAKERSVAIGWFNIGSSIGALCAPPLVVWTILHGGWKMSFVVVGALGVIWFVLWMLFYKS 187 P +ER+ AIG++ G +G P++ W GW M FV GA+G++W V+W Y+ Sbjct: 139 PERERATAIGFYTSGQFVGLAFLTPVLAWLQHEFGWHMVFVTTGAVGIVWAVIWYAVYRE 198 Query: 188 PRDQKLLSPEERAYILEG------QEKSPEKVQRESWTK---IVRSRNFWSIAIPRFLSE 238 PRD K + E I EG Q + + SWT ++ R W I + +F Sbjct: 199 PRDFKGANDAEIDLIREGGGLVDIQAEQARVKAKFSWTDLGIVLTKRKLWGIYLGQFCLN 258 Query: 239 PAWQTFNAWIPLYMATERHMNIKEIAMFAWLPFLAADIGCVLGGYLSPLFHKHLKVSLFT 298 F W P Y+ R M+ + + A LPFLAA IG + G+ S + ++ Sbjct: 259 STLWFFLTWFPTYLVKYRGMDFIKSGLLASLPFLAAFIGVLCSGFFSDFLIRR-GYTVGF 317 Query: 299 SRKLVMLVGSLSMIGPACVGFVDSPYVAIALLSIGGFAHQTLSGALYSITSDVFTKNQVA 358 +RKL ++ G L FV+S + IA L++ F + L+ +S+ S + + Sbjct: 318 ARKLPIISGLLISTSIIGANFVESTPLVIAFLALAFFGN-GLASITWSLVSTLAPARLLG 376 Query: 359 TATGLTGMSGYLGATLFTLLFGILVTQIGYGPLFVLLAAFDLV 401 G+ G L A ++ G L T + P ++ L+ Sbjct: 377 LTGGVFNFIGNLSAIATPIVIGFLATGDSFAPAITYISVLALI 419 Lambda K H 0.327 0.138 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 555 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 436 Length adjustment: 32 Effective length of query: 386 Effective length of database: 404 Effective search space: 155944 Effective search space used: 155944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory