Align phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (EC 1.1.1.343) (characterized)
to candidate PfGW456L13_3001 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)
Query= BRENDA::G5EBD7 (332 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 Length = 326 Score = 420 bits (1079), Expect = e-122 Identities = 207/331 (62%), Positives = 251/331 (75%), Gaps = 10/331 (3%) Query: 1 MRIGIIGLGRMGGNIAVRLTRHGHDVVVHDRTSEVTTSVVGRCEAGRATPADTLADMAKL 60 M++GIIGLGRMGGNIA RL +GH VV+DR + ++ G + D+ L Sbjct: 1 MQLGIIGLGRMGGNIARRLMLNGHTTVVYDRNTAFVEALATEGSTG-------VTDLPAL 53 Query: 61 LEG-DEHRVVWVMLPAGAITEDCVQQLGGLLGRGDIIIDGGNTYYKDDVRRSAELAEKGI 119 + G R VWVMLPAGA TE+ + L LL GD IIDGGNT+YKDD+RR+ L+EKG+ Sbjct: 54 VAGLARPRAVWVMLPAGAPTEETIDTLSTLLDAGDTIIDGGNTFYKDDIRRAKTLSEKGL 113 Query: 120 SYVDVGTSGGVWGLERGYCMMFGGTKETAEYIDPILSALAPGIGDVPRTPGRDEAGHDPR 179 Y+DVGTSGGVWGLERGYCMM GG ET + +DP+ + LAPG+GD+PRT +D D R Sbjct: 114 HYIDVGTSGGVWGLERGYCMMIGGDAETVKRLDPLFATLAPGLGDIPRT--KDRKSDDDR 171 Query: 180 AEQGYLHCGPAGSGHFVKMVHNGIEYGMMQAFAEGFDIMKSKNSPILAEKDRFELNMGDI 239 AE+GY+H GPAGSGHFVKM+HNGIEYGMMQAFAEGFDI+K+KNS L + RF+LN+ DI Sbjct: 172 AERGYIHAGPAGSGHFVKMIHNGIEYGMMQAFAEGFDILKTKNSESLPQDQRFDLNVADI 231 Query: 240 AEVWRRGSVVSSWLLDLTAEALTRSETLNEFSGEVADSGEGRWTIEAAIEEDVPAPVMTA 299 AEVWRRGSVVSSWLLDLTA+AL L+ FSG VADSGEG+WTIEAA+E+ VP PV++ Sbjct: 232 AEVWRRGSVVSSWLLDLTADALASDPKLDGFSGSVADSGEGQWTIEAAMEQAVPVPVLSN 291 Query: 300 ALFTRFRSRSGNNFAEKILSAQRFGFGGHVE 330 +LF+R+RSR F +KILSAQRFGFGGHVE Sbjct: 292 SLFSRYRSRGQGTFGDKILSAQRFGFGGHVE 322 Lambda K H 0.318 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 326 Length adjustment: 28 Effective length of query: 304 Effective length of database: 298 Effective search space: 90592 Effective search space used: 90592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate PfGW456L13_3001 (6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44))
to HMM TIGR00872 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00872.hmm # target sequence database: /tmp/gapView.23384.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00872 [M=299] Accession: TIGR00872 Description: gnd_rel: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-123 395.7 0.0 7.2e-123 395.5 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 6-phosphogluconate dehydrogenase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 395.5 0.0 7.2e-123 7.2e-123 1 298 [. 1 325 [. 1 326 [] 0.98 Alignments for each domain: == domain 1 score: 395.5 bits; conditional E-value: 7.2e-123 TIGR00872 1 mklgliGlGrmGaniakrlakrghevvgydrdqdaveelkedraegvanlkellk 55 m+lg+iGlGrmG nia+rl+ +gh v+ydr+ + ve+l+ ++++gv++l l+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 1 MQLGIIGLGRMGGNIARRLMLNGHTTVVYDRNTAFVEALATEGSTGVTDLPALVA 55 9****************************************************** PP TIGR00872 56 rlsaprvvwvmvpag.ivdavleelapllekGdividgGnsyykdslrrekelke 109 l pr vwvm+pag +++ ++ l+ ll++Gd++idgGn++ykd++rr k l e lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 56 GLARPRAVWVMLPAGaPTEETIDTLSTLLDAGDTIIDGGNTFYKDDIRRAKTLSE 110 ***************66899*********************************** PP TIGR00872 110 kgihlldvGtsGGvlGkerGyclmiGGdeeafkkaeplfk............... 149 kg+h++dvGtsGGv+G erGyc+miGGd e+ k+ +plf+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 111 KGLHYIDVGTSGGVWGLERGYCMMIGGDAETVKRLDPLFAtlapglgdiprtkdr 165 ******************************************************* PP TIGR00872 150 ..dvaveekGylylGeaGsGhfvkmvhnGieyGlmaalaeGlevlkns....... 195 d e+Gy+++G+aGsGhfvkm+hnGieyG+m+a+aeG+++lk lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 166 ksDDDRAERGYIHAGPAGSGHFVKMIHNGIEYGMMQAFAEGFDILKTKnseslpq 220 *98888999************************************97777***** PP TIGR00872 196 ..qfdfdleevarvyrrGsvirsflldltakaleesadleeveGrvedsGeGrwt 248 +fd ++ ++a+v+rrGsv+ s+lldlta al+ +++l+ ++G v dsGeG+wt lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 221 dqRFDLNVADIAEVWRRGSVVSSWLLDLTADALASDPKLDGFSGSVADSGEGQWT 275 *99**************************************************** PP TIGR00872 249 vkaavdlgvpapvlatslqerfasrekddfankvlaalrkefGghaekkk 298 ++aa+++ vp+pvl++sl +r++sr + +f +k+l+a r fGgh e k lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3001 276 IEAAMEQAVPVPVLSNSLFSRYRSRGQGTFGDKILSAQRFGFGGHVETSK 325 *********************************************98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (326 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.26 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory