Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate PfGW456L13_3607 Amino acid ABC transporter, permease protein
Query= reanno::pseudo5_N2C3_1:AO356_00475 (220 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3607 Length = 281 Score = 134 bits (337), Expect = 2e-36 Identities = 76/202 (37%), Positives = 119/202 (58%), Gaps = 4/202 (1%) Query: 15 DTLLAGLGLGLSLALVSIAIGCVIGLAMAFALLSKHRVLRVLASVYVTVIRNTPILVLIL 74 D L G L L L SI + ++G A A LS+ V +AS Y + R TP+L+ IL Sbjct: 72 DGFLQGAALTLFLCFCSIWLSLLLGFVTALARLSRSAVAFGVASFYASFFRGTPLLIQIL 131 Query: 75 LIYFALPSLGIRLDKLPSFVITLSLYAGAYLTEVFRGGLLSIHKGQREAGLAIGLGEWQV 134 LIY LP LG+ + + +I LSL GAYL+E+FR G++++ GQREA +A+GLG Sbjct: 132 LIYLGLPQLGVVPGAISAGIIALSLNYGAYLSEIFRAGIMAVAPGQREAAMALGLGPVAT 191 Query: 135 KAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVIETWLVT 194 ++ +P +R ++P ++ FIS+ KD+SL + + V E+ + A+ SYR IE ++T Sbjct: 192 FLHIVLPQAMRTIIPPTTSQFISMLKDSSLISVMGVWEVMFLAQSYGRSSYRYIE--MLT 249 Query: 195 TALYVAACYLIAMVLRYFEQRL 216 TA + +L+++ L + RL Sbjct: 250 TAAVI--YWLLSIGLELIQNRL 269 Lambda K H 0.329 0.142 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 281 Length adjustment: 24 Effective length of query: 196 Effective length of database: 257 Effective search space: 50372 Effective search space used: 50372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory