Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate PfGW456L13_1700 Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)
Query= reanno::pseudo5_N2C3_1:AO356_00470 (220 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1700 Length = 365 Score = 109 bits (272), Expect = 8e-29 Identities = 62/205 (30%), Positives = 112/205 (54%), Gaps = 6/205 (2%) Query: 19 WAGFLTSVQCSLLAIVLGTLIGLVAGLVLTYGRTWMRAPFRFYVDLIRGTPVFVLVLACF 78 W G + ++ + + I +G+V L +R +++ RG P+ ++ Sbjct: 155 WGGLMLTLVIATVGIAGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSS 214 Query: 79 YMAPAL---GWQIGAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASQAIGLTFYQS 135 M P G ++G+ LF ++VAE+VRG LQA+P+GQ EA+ A+GL +++S Sbjct: 215 VMLPLFLPEGMNFDKLLRALIGVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRS 274 Query: 136 LGYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIAR---TFMTLEFY 192 +G V+LPQAL+ ++P VN+ + K ++L+ +IG+ +LL S +Q A M E Y Sbjct: 275 MGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGY 334 Query: 193 LFAGFLFFIINYAIELLGRHIEKRV 217 +FA +F+I + + H+E+++ Sbjct: 335 VFAALVFWIFCFGMSRYSMHLERKL 359 Lambda K H 0.330 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 365 Length adjustment: 26 Effective length of query: 194 Effective length of database: 339 Effective search space: 65766 Effective search space used: 65766 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory