Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate PfGW456L13_876 Glutamate transport ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_876 Length = 245 Score = 258 bits (658), Expect = 1e-73 Identities = 140/247 (56%), Positives = 176/247 (71%), Gaps = 10/247 (4%) Query: 12 PLLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIM 71 PLL I L K YG VLKG+DLS++ G VV +IG SGSGK+TLLR +N LE G I Sbjct: 2 PLLRISALHKYYGDHHVLKGIDLSIEEGQVVAIIGRSGSGKSTLLRTLNGLESINDGVIE 61 Query: 72 LDGESIGYDDIDGKRVRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLP 131 +DGE + D + +R +KV GM FQQFNLFPHLT +NV L V+K+P Sbjct: 62 VDGEYLDAARADLRSLR--QKV--------GMVFQQFNLFPHLTVGENVMLAPQVVQKVP 111 Query: 132 KDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDP 191 K +A LA + LERVGL E+ D FP +LSGGQQQRVAIARA+AM+P ++L DE+TSALDP Sbjct: 112 KAKAAELARQMLERVGLGEKFDAFPDRLSGGQQQRVAIARALAMSPKVLLCDEITSALDP 171 Query: 192 ELVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQS 251 ELV EVL+V++ LA +GMT+++VTHEMRFA EV DK+VFM+QG++ E G PK LF PQ+ Sbjct: 172 ELVNEVLSVVRQLAREGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGDPKVLFANPQT 231 Query: 252 PRLAEFL 258 LA F+ Sbjct: 232 AELANFI 238 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 245 Length adjustment: 24 Effective length of query: 239 Effective length of database: 221 Effective search space: 52819 Effective search space used: 52819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory