Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate PfGW456L13_2830 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= reanno::Smeli:SM_b21216 (360 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2830 Length = 361 Score = 228 bits (581), Expect = 2e-64 Identities = 132/320 (41%), Positives = 190/320 (59%), Gaps = 25/320 (7%) Query: 2 SALEIRNIRKRY----GEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSG 57 +A+E+RN+ KRY G L + + + EF LLG SGCGK+TLL IAG S Sbjct: 5 TAIEVRNVSKRYSDDPGLAPALDNVSVDIADNEFFTLLGPSGCGKTTLLRTIAGFEHVSD 64 Query: 58 GDILIGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDT 117 G+I + V + P R + VFQSYAL+P++SVA+NI FGLEM+ + + + V + Sbjct: 65 GEIRLAGEPVNDLPPFKRRVNTVFQSYALFPHMSVAQNIAFGLEMQGLDRKLIPQRVDEM 124 Query: 118 ARLLQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELK 177 L+Q+++L RKP++LSGGQ+QRVA+ RAL P+V L DEPLS LD KLR EM+ ELK Sbjct: 125 LALVQMQHLAKRKPAELSGGQQQRVALARALAPKPKVLLLDEPLSALDLKLRKEMQVELK 184 Query: 178 RLHQMLRTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSP 237 R+ + T ++VTHDQ EA+TL+ RIAVM G+I Q+ +P+E+Y+RP +VA F+G Sbjct: 185 RVQKEAGITFIFVTHDQEEALTLSDRIAVMSAGKILQIGSPNEIYERPQHQFVAQFIGD- 243 Query: 238 PMNILDAEM----------TANGLKIEGCEEVLPLPAAFNGAAWAGRRVKVGIRPEALRL 287 +N L + NG+ +E +P PA + G +V++ RPE +L Sbjct: 244 -INFLPGHIKRGQQNEKLFVPNGMPVE-----IPCPA----QGFDGSKVQLAFRPERSQL 293 Query: 288 AAGSEAQRLTASVEVVELTG 307 ++ L +E V G Sbjct: 294 VEPTQPHHLRGVIEAVLYVG 313 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 361 Length adjustment: 29 Effective length of query: 331 Effective length of database: 332 Effective search space: 109892 Effective search space used: 109892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory