Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate PfGW456L13_686 Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)
Query= reanno::Caulo:CCNA_00453 (363 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_686 Length = 610 Score = 128 bits (321), Expect = 5e-34 Identities = 115/382 (30%), Positives = 168/382 (43%), Gaps = 25/382 (6%) Query: 1 MEATVLTRHETPAPTGASPPSLAPASTHMFREAGEAARVAAVQLTANAPKIQALAQRLRA 60 ++ V+ R GA M +E E V L + Q L Q Sbjct: 225 VDGKVVEREAVQYRDGAEAAEKGEFRHFMLKEIHEQPSVVQRTLEGRLSQNQVLVQAFGP 284 Query: 61 NPP------RVVVTCARGSSDHAATFARYLIETKAGVLTSSAGPSVSSVYDASPNLEGAL 114 R V A G+S HA ARY +E AG+ S Y L Sbjct: 285 QAAELFAKVRNVQIVACGTSYHAGMVARYWLEELAGIPCQVEVASEFR-YRKVVVQPDTL 343 Query: 115 YLAISQSGKSPDLLAAVKAAKAAGAHA-VALVNVVDSPLAALADEVIPLHAGPELSVAAT 173 ++ ISQSG++ D LAA++ AK G A +A+ NV S L +D + AG E+ VA+T Sbjct: 344 FVTISQSGETADTLAALRNAKELGFLASLAICNVGISSLVRESDLTLLTQAGREIGVAST 403 Query: 174 KSYIAALVAVTQLIAAWTE---------DAELTAALQDLPTALAAAWTLDWSLAV--ERL 222 K++ LV + L + + +A L L+ LPT L A +D ++ E Sbjct: 404 KAFTTQLVGLLLLTLSLGQVRGTLAKGVEATLVEELRRLPTRLGEALAMDSTVEKISELF 463 Query: 223 KTASNLYVLGRGVGFGVALEAALKFKETCGLHAEAFSAAEVLHGPMALVKDGFPALVFAQ 282 + LGRG F VA+E ALK KE +HAEA+ A E+ HGP+ALV + P + A Sbjct: 464 AEKHHTLFLGRGAQFPVAMEGALKLKEISYIHAEAYPAGELKHGPLALVDNDMPVVTVAP 523 Query: 283 NDESRASVDEMAAGLRARGASVLI-----AG-GGGDAPDALPTLASHPVLEPILMIQSFY 336 N+E + +RARG +++ AG G+ + H +L PIL Sbjct: 524 NNELLEKLKSNLQEVRARGGQLIVFADEKAGMTNGEGTHVVHMPHIHDILSPILYTIPLQ 583 Query: 337 RMANALSVARGYDPDSPPHLNK 358 ++ ++V +G D D P +L K Sbjct: 584 LLSYYVAVLKGTDVDQPRNLAK 605 Lambda K H 0.315 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 610 Length adjustment: 33 Effective length of query: 330 Effective length of database: 577 Effective search space: 190410 Effective search space used: 190410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory