Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate PfGW456L13_4507 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)
Query= SwissProt::P75682 (302 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4507 Length = 292 Score = 134 bits (337), Expect = 3e-36 Identities = 88/293 (30%), Positives = 152/293 (51%), Gaps = 6/293 (2%) Query: 6 LFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIA 65 + G + + T A G+LD + L+D ++ G + +G+ GE + L E + Sbjct: 1 MIAGSMVALVTPMDAQGRLDWDSLSKLVDFHLENGTHAIVAVGTTGESATLDVNEHIEVI 60 Query: 66 RFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFE 125 R + V+ R+PV+ GTG + RE +EL+++A++AGAD +++ PYY K ++ L +F+ Sbjct: 61 RAVVKQVNGRIPVIAGTGANSTREAVELTRNAKEAGADACLLVVPYYNKPTQEGLYLHFK 120 Query: 126 QVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKG 185 +A+SV +P +LYN P T D+ V L+ + NIIGIK+ + ++++ G Sbjct: 121 HIAESVDIPQILYNVPGRTSCDMQAETVIRLS-TVPNIIGIKEATGDLKRAKAIL---DG 176 Query: 186 AHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTL 245 F VL G D +L+GG G IS + N AP+ +L +A GD A ++ L Sbjct: 177 VSKDFIVLSGDDPTAVELILMGGKGNISVTANVAPREMADLCEAALKGDAETARAINEKL 236 Query: 246 LQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQ 298 + + + ++ + V K A+V G + + P + L P L+T L+Q Sbjct: 237 MPLHKDLFIEANPIPV-KWALVEMGL-MHEGIRLPLTWLSAPCHETLRTALRQ 287 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 292 Length adjustment: 26 Effective length of query: 276 Effective length of database: 266 Effective search space: 73416 Effective search space used: 73416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory