Align D-mannonate oxidoreductase; EC 1.1.1.57; Fructuronate reductase (uncharacterized)
to candidate PfGW456L13_3038 Multiple polyol-specific dehydrogenase (EC 1.1.1.-)
Query= curated2:P39160 (486 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3038 Length = 490 Score = 342 bits (877), Expect = 2e-98 Identities = 188/470 (40%), Positives = 267/470 (56%), Gaps = 6/470 (1%) Query: 11 VARPSWDHSRLESRIVHLGCGAFHRAHQALYTHHLLESTDS-DWGICEVNLMPGNDRVLI 69 V P++ I H+G G FHRAHQA YT L+ + + DW IC V L DR Sbjct: 15 VVLPAYALGETRQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWAICGVGLR-AEDRRAR 73 Query: 70 ENLKKQQLLYTVAEKG-AESTELKIIGSMKEALHPEIDGCEGILNAMARPQTAIVSLTVT 128 ++LK Q L+T+ E G + TE+++IG++++ L E D + +++ +A P+ IVSLT+T Sbjct: 74 DDLKDQDYLFTLFELGDSGDTEVRVIGALRDMLLAE-DSAQALIDKLASPEIRIVSLTIT 132 Query: 129 EKGYCADAASGQLDLNNPLIKHDLENPTAPKSAIGYIVEALRLRREKGLKAFTVMSCDNV 188 E GYC D ++G+ + P I+HDL +P APK+ G++ AL RR G AFT+MSCDN+ Sbjct: 133 EGGYCIDDSTGEFMAHLPQIQHDLAHPGAPKTVFGFLCAALAKRRAAGTAAFTLMSCDNL 192 Query: 189 RENGHVAKVAVLGLAQARDPQLAAWIEENVTFPCTMVDRIVPAATPETLQEIADQLGVYD 248 NG V + A+L A D QL WI+ NV+FP MVDRI P + ++AD+ GV D Sbjct: 193 PHNGAVTRKALLAFAALHDSQLRDWIDTNVSFPNAMVDRITPMTSTLHRLQLADRHGVDD 252 Query: 249 PCAIACEPFRQWVIEDNFVNGRPDWDKVGAQFVADVVPFEMMKLRMLNGSHSFLAYLGYL 308 + CEPF QWV+ED FVNGRP W+KVG QF DV P+E MK+++LNGSH L YLG+L Sbjct: 253 AWPVVCEPFAQWVLEDRFVNGRPAWEKVGVQFTDDVTPYEEMKIKLLNGSHLALTYLGFL 312 Query: 309 GGYETIADTVTNPAYRKAAFALMMQEQAPTLSMPEGTDLNAYATLLIERFSNPSLRHRTW 368 GY + + + +P + + A M + P L G DL Y L+ RFSN ++ + Sbjct: 313 KGYRFVHEAMNDPLFVRYMRAYMDLDVTPQLPAVPGIDLAEYKNTLVARFSNQAIADQLE 372 Query: 369 QIAMDGSQKLPQRLLDPVRLHLQNGGSWRHLALGVAGWMRYTQGVDEQGNAIDVVDPMLA 428 ++ DGS K P+ + + + +G R AL VA W Y +GVDEQG + DP A Sbjct: 373 RVCSDGSSKFPKFTVPTINRLIADGCDTRRAALVVAAWALYLKGVDEQGETYTIADPRAA 432 Query: 429 EFQKINAQYQGADRVKALLGLSGIFADDLPQNADFVGAVTAAYQQLCERG 478 Q + A + LL + IF + ++ +FV A L E G Sbjct: 433 FCQALVA--DDVLITQRLLAVEEIFGTAIARSPEFVAAFEWCCNSLREVG 480 Lambda K H 0.320 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 654 Number of extensions: 32 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 490 Length adjustment: 34 Effective length of query: 452 Effective length of database: 456 Effective search space: 206112 Effective search space used: 206112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory