Align Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized)
to candidate PfGW456L13_1700 Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)
Query= TCDB::Q9I404 (222 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1700 Length = 365 Score = 136 bits (342), Expect = 6e-37 Identities = 77/218 (35%), Positives = 122/218 (55%), Gaps = 7/218 (3%) Query: 6 GIVPALPSLWEGMLMTLKLMVLGVLGGVALGTVLALMRLSHSKLLSNIAGFYVNYFRSIP 65 G+ S W G+++TL + +G+ G + LG VLAL R S+ + + ++ ++R +P Sbjct: 146 GLDAVATSQWGGLMLTLVIATVGIAGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVP 205 Query: 66 LLLVITWFYFAVPFILRWITGEDTPVGAFTSCLVAFMMFEAAYYCEIVRAGIQAIPKGQM 125 L+ V+ +P L E L+ ++F++AY E+VR G+QAIPKGQ Sbjct: 206 LITVLFMSSVMLPLFLP----EGMNFDKLLRALIGVILFQSAYVAEVVRGGLQAIPKGQY 261 Query: 126 GAAQALGMTYGQTMRLVILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLMDFLNSARSRG 185 AA A+G+ Y ++M LVILPQA + + P ++ I LF+DTSLV +GL D LNS + Sbjct: 262 EAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAA 321 Query: 186 ---DIIGQANEFLIFAGLVYFVVSFTASFAVKRLQKRL 220 +G A E +FA LV+++ F S L+++L Sbjct: 322 ADPKWLGMATEGYVFAALVFWIFCFGMSRYSMHLERKL 359 Lambda K H 0.331 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 365 Length adjustment: 26 Effective length of query: 196 Effective length of database: 339 Effective search space: 66444 Effective search space used: 66444 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory