Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate PfGW456L13_877 Putative amino acid ABC transporter, permease protein
Query= TCDB::A1VZQ3 (250 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_877 Length = 216 Score = 125 bits (313), Expect = 9e-34 Identities = 66/218 (30%), Positives = 120/218 (55%), Gaps = 6/218 (2%) Query: 26 ISPFAVWKFLDALDNKDAFINGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTR 85 +S F W + L + G +TL +S++A + + G + VM S+ + R++ R Sbjct: 1 MSDFTFWDIVRNL------LTGLQWTLALSLVAFIGGGLIGLLIMVMRISKKSLPRSFAR 54 Query: 86 IYVELFQNVPLVIQIFFLFYALPVLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPR 145 Y+ELFQ PL++Q+F +F+ + + GI + + + + + AY++E+ R + ++P Sbjct: 55 TYIELFQGTPLLMQLFLVFFGVALAGIEISPWMAAAIALTLFTSAYLAEIWRGCVDSIPN 114 Query: 146 GQFEASASQGFTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSAD 205 GQ+EAS+S ++Q+R++I+PQ +RI + P V ++K T+V I+G EL + Sbjct: 115 GQWEASSSLALNPLEQLRHVILPQALRIAVAPTVGFSVQVVKGTAVTSIIGFTELTKTGG 174 Query: 206 SYAADYGNYAPAYIFAAVLYFIICYPLAYFAKAYENKL 243 A Y A+ YF++CYPL+ A+ E +L Sbjct: 175 MLANATFEPFMVYGLVALGYFLLCYPLSLSARYLERRL 212 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 216 Length adjustment: 23 Effective length of query: 227 Effective length of database: 193 Effective search space: 43811 Effective search space used: 43811 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory