Align PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 (characterized)
to candidate PfGW456L13_4832 PTS system, glucose-specific IIA component / Phosphotransferase system, phosphocarrier protein HPr / Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)
Query= SwissProt::A0A0H3H456 (472 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4832 Length = 838 Score = 113 bits (282), Expect = 3e-29 Identities = 101/325 (31%), Positives = 149/325 (45%), Gaps = 22/325 (6%) Query: 163 IQNHNGLHVRPASKLVAALAGFNADLVLEKGGKCVTPDSLNQIALLQVRRNDTLRLLARG 222 I + GLH RPA+ + GF + L GK T DSL + L + +++ +G Sbjct: 178 IAHRGGLHARPAALIRQTAQGFKSKSQLHFAGKSATCDSLIGLMGLAIGEQAEVQVSCQG 237 Query: 223 PDADAALAAF-----QALAAENF-GEPTEAAPARRPASADRVEGKVV---LYPQP---QD 270 PDA+AAL A ALA ++ PT A RPA A + G L P + Sbjct: 238 PDAEAALQALLTALSTALAEDSHAAAPTTIAQRNRPAEAGVLHGVCAAPGLVGGPLFHLN 297 Query: 271 RISRETSAA---IGQQQLRLKRAIDRTLEDLSALTTLAEATFSADIAAIFSGHHTLLDDP 327 IS A QQQ L A+ + ++ LA+ AIF+ H LL+DP Sbjct: 298 AISLPVDAGHHDPQQQQQVLDAALSQVRSEIERTLVLAKKHKDTAEEAIFAAHLALLEDP 357 Query: 328 DLYAAACDIIRDEQCSAAWAWQQVLSDLSQQYRHLDDAYLQARYIDIEDILHRTLRHL-- 385 L AA + + +A AW Q + + + L R D+ D+ R LR L Sbjct: 358 ALLDAAIQTVA-QGTAATHAWSQAIDVQCEVLQQTGSTLLAERANDLRDLKQRVLRALLG 416 Query: 386 NERNEALPQFSAPSILVADDIFPSTVLQLNAEQVKGICLQAGSELSHGAIIARQAGI-AM 444 + + +P A +I+ A ++ PS +LQL+ + V G+C+ G SH AI+AR G+ M Sbjct: 417 DTWHYDVP---AGAIVAAHELTPSDLLQLSQQGVAGLCMAEGGATSHVAILARGKGLPCM 473 Query: 445 LCQQSDALTLQDGENVILDIPGKRV 469 + S L Q G+ V+LD G R+ Sbjct: 474 VALGSTLLDQQQGQPVVLDADGGRL 498 Lambda K H 0.318 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 766 Number of extensions: 43 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 838 Length adjustment: 38 Effective length of query: 434 Effective length of database: 800 Effective search space: 347200 Effective search space used: 347200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory