Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate PfGW456L13_445 Cystine ABC transporter, permease protein
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_445 Length = 221 Score = 154 bits (389), Expect = 1e-42 Identities = 81/215 (37%), Positives = 130/215 (60%), Gaps = 1/215 (0%) Query: 1 MELDFSPVWAGVPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYV 60 ME F P LL GA TV ++ + G VMG + + RL+ + ++V + YV Sbjct: 1 MEEAFQLALDSAPFLLKGAYYTVILSLGGMFFGLVMGFGLALMRLS-RFKLVSWIARIYV 59 Query: 61 AAIRGTPLLVQLFILFFGLPQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQM 120 + RGTPLLVQLF++++GLPQ G+ L +IG + AY E++R AI SI++GQ Sbjct: 60 SFFRGTPLLVQLFVIYYGLPQLGLELDPLPAALIGFSLNMAAYACEILRAAISSIERGQW 119 Query: 121 EAARSIGMSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKII 180 EAA SIGM+ +R +LPQA+ +PPLGN FI+L+K++AL + + + +L + Q I Sbjct: 120 EAAASIGMTRAQTLRRAILPQAMRTALPPLGNSFISLVKDTALAATIQVPELFRQAQLIT 179 Query: 181 SVSYRSLEVYLAIAVVYFILTGATTLVLRRIELRL 215 + ++ +YLA A++Y++L + + ++E R+ Sbjct: 180 ARTFEIFTMYLAAALIYWVLATVLSHLQNQLEARV 214 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 221 Length adjustment: 22 Effective length of query: 200 Effective length of database: 199 Effective search space: 39800 Effective search space used: 39800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory