Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate PfGW456L13_316 N-formylglutamate deformylase (EC 3.5.1.68)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_316 (267 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 Length = 267 Score = 552 bits (1422), Expect = e-162 Identities = 267/267 (100%), Positives = 267/267 (100%) Query: 1 VDKVLNFKQGRVPLLISMPHAGVRLTPAVEAGLIPDAKSLPDTDWHIPQLYDFAAELGAS 60 VDKVLNFKQGRVPLLISMPHAGVRLTPAVEAGLIPDAKSLPDTDWHIPQLYDFAAELGAS Sbjct: 1 VDKVLNFKQGRVPLLISMPHAGVRLTPAVEAGLIPDAKSLPDTDWHIPQLYDFAAELGAS 60 Query: 61 TLAAEYSRFVIDLNRPSDDKPLYVGATTGLYPATLFDGIPLFREGLEPSKEERATYLEQI 120 TLAAEYSRFVIDLNRPSDDKPLYVGATTGLYPATLFDGIPLFREGLEPSKEERATYLEQI Sbjct: 61 TLAAEYSRFVIDLNRPSDDKPLYVGATTGLYPATLFDGIPLFREGLEPSKEERATYLEQI 120 Query: 121 WTPYHSTLQQELARLKAEFGYALLFDAHSIRSIIPHLFDGKLPDFNLGTFNGASCDPQLA 180 WTPYHSTLQQELARLKAEFGYALLFDAHSIRSIIPHLFDGKLPDFNLGTFNGASCDPQLA Sbjct: 121 WTPYHSTLQQELARLKAEFGYALLFDAHSIRSIIPHLFDGKLPDFNLGTFNGASCDPQLA 180 Query: 181 TRLEAICALHDNYTHVLNGRFKGGHITRHYGNPAENIHAVQLELGQCTYMEEFEPFRYRP 240 TRLEAICALHDNYTHVLNGRFKGGHITRHYGNPAENIHAVQLELGQCTYMEEFEPFRYRP Sbjct: 181 TRLEAICALHDNYTHVLNGRFKGGHITRHYGNPAENIHAVQLELGQCTYMEEFEPFRYRP 240 Query: 241 DLAEPTRLVLKELLQGLLAWGEKHYKR 267 DLAEPTRLVLKELLQGLLAWGEKHYKR Sbjct: 241 DLAEPTRLVLKELLQGLLAWGEKHYKR 267 Lambda K H 0.321 0.140 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate PfGW456L13_316 (N-formylglutamate deformylase (EC 3.5.1.68))
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.31392.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-123 395.6 0.0 6.1e-123 395.4 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 N-formylglutamate deformylase (E Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 N-formylglutamate deformylase (EC 3.5.1.68) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 395.4 0.0 6.1e-123 6.1e-123 2 262 .. 4 262 .. 3 263 .. 0.99 Alignments for each domain: == domain 1 score: 395.4 bits; conditional E-value: 6.1e-123 TIGR02017 2 alevqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGa 57 +l++++G++Pllis+Ph+G++lt+ave++l +ak+l dtdWhi +lydfa +lGa lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 4 VLNFKQGRVPLLISMPHAGVRLTPAVEAGLIPDAKSLPDTDWHIPQLYDFAAELGA 59 799***************************************************** PP TIGR02017 58 tvvraaisrlvidvnrdpsgaslypgqattgliPettfdgeplykdGeaPseaeik 113 ++++a++sr+vid+nr+ ++++ly+g attgl+P+t+fdg pl+++G +Ps++e++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 60 STLAAEYSRFVIDLNRPSDDKPLYVG-ATTGLYPATLFDGIPLFREGLEPSKEERA 114 **************************.***************************** PP TIGR02017 114 krltkyfkPyhaalraeierlralhgkivlydahsirsviPrlfeGklPdfnlGtn 169 ++l++++ Pyh++l++e++rl+a +g+++l+dahsirs iP+lf+GklPdfnlGt+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 115 TYLEQIWTPYHSTLQQELARLKAEFGYALLFDAHSIRSIIPHLFDGKLPDFNLGTF 170 ******************************************************** PP TIGR02017 170 dgkscdpaladaveavcakakglssvlnGrfkGGyitrhygqPqngvhavqlelaq 225 +g+scdp la ++ea+ca +++vlnGrfkGG+itrhyg+P++++havqlel q lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 171 NGASCDPQLATRLEAICALHDNYTHVLNGRFKGGHITRHYGNPAENIHAVQLELGQ 226 ******************************************************** PP TIGR02017 226 rgyleeetePvaydeakaealravlkellealldfae 262 +y+e e eP+ y+++ ae++r vlkell+ ll+++e lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_316 227 CTYME-EFEPFRYRPDLAEPTRLVLKELLQGLLAWGE 262 ****9.*****************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (267 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.44 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory