Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate PfGW456L13_3150 L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3150 Length = 372 Score = 279 bits (713), Expect = 7e-80 Identities = 141/262 (53%), Positives = 193/262 (73%), Gaps = 1/262 (0%) Query: 4 IEIRNVYKIFGHDAKKALT-MVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLS 62 I+ ++V+KIFG A A+ +V+ GL K IL GC VG++DVSL++ G+IF IMGLS Sbjct: 13 IDCQSVWKIFGKAAPAAMNAVVQQGLTKTQILQNYGCVVGVSDVSLQVRRGEIFCIMGLS 72 Query: 63 GSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTV 122 GSGKSTL+R +N+LI P++G+++ G + L A LR R R + MVFQS AL+P+RTV Sbjct: 73 GSGKSTLIRLLNKLITPSAGKIVVKGKELSSLNAAQLREVRARHIGMVFQSVALLPNRTV 132 Query: 123 LQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADT 182 L+N +G V+GV K + ++ + + VGLS + +++P +LSGGM+QRVGLARA+ AD Sbjct: 133 LENTAFGLEVQGVGKAERYKVAEQALAKVGLSDWMSRYPSELSGGMQQRVGLARAITADP 192 Query: 183 DVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQV 242 +VILMDE FSALDPLIR +QD+ QL + L K+ VFITHDLDEA+RIG IAI++DG + Sbjct: 193 EVILMDEPFSALDPLIRRQLQDEFRQLTKELGKSAVFITHDLDEAIRIGDRIAIMKDGAI 252 Query: 243 VQVGTPNDILDNPANDYVARFV 264 +QVGT +I+ NPA+DYVA FV Sbjct: 253 IQVGTAEEIVLNPADDYVAEFV 274 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 372 Length adjustment: 28 Effective length of query: 247 Effective length of database: 344 Effective search space: 84968 Effective search space used: 84968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory