Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate PfGW456L13_3427 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::P30084 (290 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3427 Length = 272 Score = 175 bits (444), Expect = 9e-49 Identities = 103/245 (42%), Positives = 143/245 (58%), Gaps = 4/245 (1%) Query: 47 VGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTG-GDKAFAAGADIKEMQN 105 VG + L RP+ +NA+ D + + QAL ++DP + IV+ G GD+ F AGADIKE + Sbjct: 25 VGWVVLTRPRQINAINDEIRQGVPQALALLQQDPDIRVIVIRGEGDRGFCAGADIKERRG 84 Query: 106 --LSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQP 163 S Q + ++ + L + KPVIAA++GY GGG EL + CDI +A A FA P Sbjct: 85 PESSLQVRQRMENVRWIETLDGITKPVIAAIHGYCMGGGLELVLACDIRFAAPDAVFALP 144 Query: 164 EILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIC-PVETLVEEA 222 E +G IPG GGTQRL+R V A++M+LTGDR+ A+ A++ GLVS++ LV+E Sbjct: 145 ETGLGLIPGGGGTQRLSRVVAPGQALDMLLTGDRVGAEQAQRIGLVSRLASDSANLVQEV 204 Query: 223 IQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEK 282 A++IAS A K++ AA EM L G LE LF T D +E AF E+ Sbjct: 205 RAFAQRIASKPPTASAFVKQAARAALEMDLKRGLDLELDLFALLAPTKDAREAAQAFSER 264 Query: 283 RKANF 287 R+ F Sbjct: 265 REPRF 269 Lambda K H 0.319 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 272 Length adjustment: 26 Effective length of query: 264 Effective length of database: 246 Effective search space: 64944 Effective search space used: 64944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory