GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dgoD in Pseudomonas fluorescens GW456-L13

Align L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 (characterized)
to candidate PfGW456L13_3320 L-arabonate dehydratase (EC 4.2.1.25)

Query= SwissProt::B5ZZ34
         (579 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3320 L-arabonate
           dehydratase (EC 4.2.1.25)
          Length = 578

 Score =  744 bits (1921), Expect = 0.0
 Identities = 369/571 (64%), Positives = 450/571 (78%), Gaps = 2/571 (0%)

Query: 11  LRSQEWYGGTSRDVIYHRGWLKNQGYPHDLFDGRPVIGILNTWSDMTPCNGHLRELAEKV 70
           LRS +W+G   ++   +R W+KNQG     F G+P+IGI NTWS++TPCN H R++AE V
Sbjct: 8   LRSAQWFGTADKNGFMYRSWMKNQGIADHQFHGKPIIGICNTWSELTPCNAHFRQIAEHV 67

Query: 71  KAGVWEAGGFPLEVPVFSASENTFRPTAMMYRNLAALAVEEAIRGQPMDGCVLLVGCDKT 130
           K GV EAGGFP+E PVFS  E+  RPTAM+ RNLA++ VEEAIRG P+DG VLL GCDKT
Sbjct: 68  KRGVIEAGGFPVEFPVFSNGESNLRPTAMLTRNLASMDVEEAIRGNPIDGVVLLTGCDKT 127

Query: 131 TPSLLMGAASCDLPSIVVTGGPMLNGYFRGERVGSGTHLWKFSEMVKAGEMTQAEFLEAE 190
           TP+LLMGAASCD+P+IVVTGGPMLNG  +G+ +GSGT +W+ SE VKAG ++  +FL AE
Sbjct: 128 TPALLMGAASCDVPAIVVTGGPMLNGKHKGKDIGSGTVVWQLSEQVKAGTISIDDFLAAE 187

Query: 191 ASMSRSSGTCNTMGTASTMASMAEALGMALSGNAAIPGVDSRRKVMAQLTGRRIVQMVKD 250
             MSRS+GTCNTMGTASTMA MAEALG +L  NAAIP VD+RR V+A ++G R V+MV++
Sbjct: 188 GGMSRSAGTCNTMGTASTMACMAEALGTSLPHNAAIPAVDARRYVLAHMSGMRAVEMVRE 247

Query: 251 DLKPSEIMTKQAFENAIRTNAAIGGSTNAVIHLLAIAGRVGIDLSLDDWDRCGRDVPTIV 310
           DLK S+I+TK+AFENAIR NAAIGGSTNAVIHL AIAGR+G++L LDDW R GR +PTIV
Sbjct: 248 DLKLSKILTKEAFENAIRVNAAIGGSTNAVIHLKAIAGRIGVELDLDDWTRIGRGMPTIV 307

Query: 311 NLMPSGKYLMEEFFYAGGLPVVLKRLGEAGLL-HKDALTVSGETVWDEVKDVVNWNED-V 368
           +L PSG++LMEEF+YAGGLP VL+RLGEA L+ + +ALTV+G+++ +  +D   + ED V
Sbjct: 308 DLQPSGRFLMEEFYYAGGLPAVLRRLGEANLIPNPNALTVNGKSIGENTRDAPIYGEDEV 367

Query: 369 ILPAEKALTSSGGIVVLRGNLAPKGAVLKPSAASPHLLVHKGRAVVFEDIDDYKAKINDD 428
           I   +  + + GGI VLRGNLAP GAVLKPSAA+P L+ H+GRAVVFE+ D YKA+IND 
Sbjct: 368 IRTLDNPIRADGGICVLRGNLAPLGAVLKPSAATPELMQHRGRAVVFENFDMYKARINDP 427

Query: 429 NLDIDENCIMVMKNCGPKGYPGMAEVGNMGLPPKVLKKGILDMVRISDARMSGTAYGTVV 488
            LD+D N I+VMKNCGPKGYPGMAEVGNMGLP K+L +G+ DMVRISDARMSGTAYGTVV
Sbjct: 428 ELDVDANSILVMKNCGPKGYPGMAEVGNMGLPAKLLAQGVTDMVRISDARMSGTAYGTVV 487

Query: 489 LHTSPEAAVGGPLAVVKNGDMIELDVPNRRLHLDISDEELARRLAEWQPNHDLPTSGYAF 548
           LH +PEAA GGPLA VK GD IELD  + RLHLDI+D ELA R+A+ QP  +L   GY  
Sbjct: 488 LHVAPEAAAGGPLAAVKEGDWIELDCASGRLHLDIADTELAARMADLQPPQNLIVGGYRQ 547

Query: 549 LHQQHVEGADTGADLDFLKGCRGNAVGKDSH 579
           L+  HV  AD G D DFL GCRG  V + SH
Sbjct: 548 LYIDHVLQADQGCDFDFLVGCRGAEVPRHSH 578


Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1151
Number of extensions: 63
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 579
Length of database: 578
Length adjustment: 36
Effective length of query: 543
Effective length of database: 542
Effective search space:   294306
Effective search space used:   294306
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory