Align KguT (characterized, see rationale)
to candidate PfGW456L13_2481 Major facilitator family transporter
Query= uniprot:A0A167V864 (425 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2481 Length = 441 Score = 185 bits (469), Expect = 3e-51 Identities = 124/415 (29%), Positives = 204/415 (49%), Gaps = 16/415 (3%) Query: 13 YIMPIVFITYSLAYLDRANYGFAAASGMADDLHITPALSSLLGALFFLGYFFFQVPGAIY 72 +++P+ I + + Y+DR N GF S M DL I A L LFF+GY F+VP I Sbjct: 19 HVLPLFVIMFIVNYIDRVNIGFVR-SHMEHDLGIGAAAYGLGAGLFFIGYALFEVPSNIL 77 Query: 73 AEKRSVKKLIFVSLILWGGLATLTGMVQSVSLLIAIRFLLGVVEAAVMPAMLIYLCHWFT 132 +K + + ++ WG +A +Q+ + +RFLLGV EA P ++ Y W Sbjct: 78 LQKVGARIWLTRIMLTWGLVAAGMAFIQNETHFYILRFLLGVAEAGFFPGVIYYFTRWLP 137 Query: 133 RAERSRANTFLILGNPVTILWMSVVSGYLVK-----HFDWRWMFIIEGLPAV-LWAFIWW 186 ER +A + G+ + L +SG L++ W+WM+ IEG+ +V L F+W+ Sbjct: 138 GVERGKAIAIFLSGSALASLISGPLSGLLLQIEGLGLHGWQWMYFIEGMFSVGLCVFVWF 197 Query: 187 RLVDDRPEQASWLKAQEKTALREALAAEQ---QGIKPVK-NYREAFRSPKVIILSLQYFC 242 L D RP A WL +E+ AL +A+ EQ + P+K + + + ++I+ L YF Sbjct: 198 WL-DSRPHDAKWLSREEQDALVKAIDDEQLAREAATPIKPSLGKLLKDRQIILFCLIYFF 256 Query: 243 WSIGVYGFVLWLPSILKQAAALDIVTAGWLSAVPYLGAVLAMLGVSWASDRMQKRKRFVW 302 + +Y WLPSI+K+ L V G +++P+L +++ M + S + + ++ +V Sbjct: 257 IQLTIYAATFWLPSIIKKMGDLSDVQVGLFNSIPWLLSIVGMYAFASLSAKWKHQQAWVA 316 Query: 303 PPLLIAALAFYGSYILGTEHFWWSYTLLVIAGACMYAPYGPFFAIVPELLPSNVAGGAMA 362 LLIAA + S G +++ + A + F+ I L + +A G +A Sbjct: 317 TALLIAAAGMFMSTTGGPV---FAFVAICFAALGFKSASSLFWPIPQAYLDARIAAGVIA 373 Query: 363 LINSMGALGSFSGSWLVGYLNGVTGG-PGASYLFMCGALLVAVALTAVLNPSQQA 416 LINS+G LG F G L TG G Y +++ A+ + A N + A Sbjct: 374 LINSVGNLGGFVAPTTFGLLEERTGSIQGGLYGLAATSIIAAIIVFAARNTPKPA 428 Lambda K H 0.328 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 601 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 441 Length adjustment: 32 Effective length of query: 393 Effective length of database: 409 Effective search space: 160737 Effective search space used: 160737 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory