GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Pseudomonas fluorescens GW456-L13

Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate PfGW456L13_2284 Geranyl-CoA carboxylase biotin-containing subunit

Query= reanno::pseudo6_N2E2:Pf6N2E2_2194
         (649 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2284 Geranyl-CoA
           carboxylase biotin-containing subunit
          Length = 653

 Score =  581 bits (1498), Expect = e-170
 Identities = 327/661 (49%), Positives = 417/661 (63%), Gaps = 25/661 (3%)

Query: 4   PALTTLLVANRGEIACRVMRTAKAMGLTTVAVHSATDRDARHSREADIRVDLGGSKAADS 63
           P L  +L+ANRGEIACR+ RTA+A+G  TVAV S  D DA H R AD  V++G +    S
Sbjct: 2   PGLKKILIANRGEIACRIQRTAQALGYRTVAVFSDADADALHVRIADEAVNIGPAPVQQS 61

Query: 64  YLQIDKLIAAAKASGAQAIHPGYGFLSENAGFARAIENAGLIFLGPPASAIDAMGSKSAA 123
           YL I  ++ AA+ +GA AIHPGYGFLSENAGFA A  +AG+ F+GP   AI+ MGSK  +
Sbjct: 62  YLNIQAILDAARRTGADAIHPGYGFLSENAGFALACRDAGITFIGPSPEAIELMGSKRLS 121

Query: 124 KALMETAGVPLVPGYHGEAQDLETFRDAAERIGYPVLLKATAGGGGKGMKVVEDVSQLAE 183
           K  M  AGVP + GY G  QD  T    AERIGYP+++KA+AGGGG+GM++V D S L E
Sbjct: 122 KIAMIEAGVPCINGYQGAGQDDATLGREAERIGYPLMIKASAGGGGRGMRLVHDASDLLE 181

Query: 184 ALASAQREAQSSFGDSRMLVEKYLLKPRHVEIQVFADQHGNCLYLNERDCSIQRRHQKVV 243
            + +A+ EA + FG   +++E+ L++PRHVE+Q+F D+HGN +YL ERDCS+QRRHQKV+
Sbjct: 182 QIRTARSEALNGFGSGELILEQALVEPRHVEVQLFGDRHGNLIYLGERDCSVQRRHQKVI 241

Query: 244 EEAPAPGLTAQLRQAMGEAAVRAAQAIGYVGAGTVEFLLDARGEFFFMEMNTRLQVEHPV 303
           EEAP P +TA+LRQAMGEAA++A +A+ YVGAGTVEFLLDARG+F+F+EMNTRLQVEHPV
Sbjct: 242 EEAPCPVMTAELRQAMGEAALKAGRAVKYVGAGTVEFLLDARGQFYFLEMNTRLQVEHPV 301

Query: 304 TEAITGLDLVAWQIRVAQGEPLPITQAQVPLLGHAIEVRLYAEDPVNDFLPATGRLALYR 363
           TE ITGLDLVAWQ+ +A+G+PLP+ Q QV L GHA+EVRLYAEDP   FLP TGR+  + 
Sbjct: 302 TELITGLDLVAWQLSIAEGQPLPLRQEQVQLTGHAMEVRLYAEDPAQGFLPQTGRVVAW- 360

Query: 364 ESAKGPGRRVDSGVEEGDEISPFYDPMLGKLIAWGENREQARLRLLSMLDEFAIGGLKTN 423
           E A   G R+D G+ EG  ISPFYDPMLGKLIA G  RE+AR +LL  + +  + GLK+N
Sbjct: 361 EPALQDGVRIDHGLIEGQVISPFYDPMLGKLIAHGATREEARRKLLRAVQDSVLLGLKSN 420

Query: 424 IGFLRRIVAHPAFAAAELDTGFIPRYQAQLLPEPGELDDAFWLAAAQGFALSLAPHIRGD 483
              L  ++ HP FA+ +  TGFI ++         E   A  LA A       A      
Sbjct: 421 QRLLASLLEHPQFASGDFSTGFIAQHFTDHTCLHPETPGAHHLAIAAALFYQAA------ 474

Query: 484 DAGSPWASTTGMRLGLSRETTLHLSCEGQD----------RALTLDVTAHCAELK----- 528
            A +  A   G R   S      +  E QD            L + V     ELK     
Sbjct: 475 -AQAHLAPLGGWRNNASVPLHYRIGLEDQDWPVALQAIPGEPLRIQVAERSLELKIIHSD 533

Query: 529 GERLTIEHHGVRRSHRAIRQGDSLYLHW-AGDLHRIDLYDPLAAAEASHSHQGGLAAPMN 587
           G   T+E  GVR+ H    +   L L    G L  +D        +AS S  G L APM+
Sbjct: 534 GRWATLEIEGVRQRHAYRLEAGRLRLFTRPGSLQFVDRTQVQVTGQASVS-SGTLKAPMD 592

Query: 588 GSIVRVLVSVGQPVDAGAQLVVLEAMKMEHSIRAPKAGVIKALYCQEGEMVSEGSALVAF 647
           G+IV VLV+ G  V  G  LVVLEAMKMEH +++   GV+K L  + G+ V     L+  
Sbjct: 593 GAIVDVLVNEGSQVTKGQLLVVLEAMKMEHPLKSGIDGVLKRLQVKVGDQVKNRQILLEV 652

Query: 648 E 648
           E
Sbjct: 653 E 653


Lambda     K      H
   0.319    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1081
Number of extensions: 46
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 649
Length of database: 653
Length adjustment: 38
Effective length of query: 611
Effective length of database: 615
Effective search space:   375765
Effective search space used:   375765
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory