Align Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 (characterized)
to candidate PfGW456L13_52 Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)
Query= SwissProt::Q2QMG2 (737 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_52 Length = 452 Score = 403 bits (1035), Expect = e-116 Identities = 208/444 (46%), Positives = 290/444 (65%), Gaps = 5/444 (1%) Query: 39 VEKVLVANRGEIACRVMRTARRLGIPTVAVYSDADRGALHVRAADEAVRLGPPPARESYL 98 +EKVL+ANRGEIA R++R + +GI TVAVYS AD+ +H+ ADE+V +GP A SYL Sbjct: 5 LEKVLIANRGEIALRILRACKEMGIKTVAVYSKADKELMHLGLADESVCIGPASAAHSYL 64 Query: 99 NASAIVDAALRTGAKAIHPGYGFLSESADFAQLCKAEGLTFIGPPPSAIRDMGDKSASKR 158 + AI+ AA TGA AIHPGYGFL+E+ADFA+ + G FIGP IR MGDK ++K Sbjct: 65 HIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVEKSGFAFIGPKAETIRLMGDKVSAKH 124 Query: 159 IMGAAGVPLVPGYHG-AEQDIELLKLEANKIGYPVLIKPTHGGGGKGMRIVQRPEDFVDS 217 M AAGVP VPG G +D E ++GYPV+IK GGGG+GMR+V + ED + S Sbjct: 125 AMIAAGVPTVPGSDGPLPEDEETALRIGREVGYPVIIKAAGGGGGRGMRVVHKEEDLIAS 184 Query: 218 VLSAQREAAASFGINTLLVEKYITQPRHIEVQIFGDQHGNVIHLYERDCSLQRRHQKIIE 277 + EA A+FG + +EK++T PRH+EVQ+ D G IHL +RDCSLQRRHQK++E Sbjct: 185 AKLTRSEAGAAFGNPMVYLEKFLTNPRHVEVQVLSDGQGQAIHLGDRDCSLQRRHQKVLE 244 Query: 278 EAPAPNVTAQFRSHIGEAAVSAAKAVGYYSAGTVEFIVDTLSGEFYFMEMNTRLQVEHPV 337 EAPAP + R + V A +GY AGT EF+ + +G FYF+EMNTR+QVEHPV Sbjct: 245 EAPAPGIDENAREEVLARCVRACIDIGYRGAGTFEFLYE--NGRFYFIEMNTRVQVEHPV 302 Query: 338 TEMIVGQDLVEWQIRIANGECLPLSQEQVPLNGHAFEARIYAENVPRGFLPATGTLHHYR 397 +EM+ G D+V+ + IA G L +Q+ V + GHA E RI AE+ P+ F+P+ GT+ H+ Sbjct: 303 SEMVTGIDIVKEMLSIAAGNKLSFTQDDVVIRGHALECRINAED-PKTFMPSPGTVKHFH 361 Query: 398 PVPSTATVRVETGVEEGDTVSMHYDPMIAKLVVWGESRNAALVKLKNSLSNFQIAGLPTN 457 P VRV++ + G V +YD +I KL+ +G +R+ A+ +++N+L + G+ TN Sbjct: 362 -APGGNGVRVDSHLYSGYAVPPNYDSLIGKLITYGATRDEAMARMRNALDEIVVDGIKTN 420 Query: 458 VGFLQELAGHSAFEKGLVDTHFIE 481 + ++L F KG V+ H++E Sbjct: 421 IPLHRDLTRDEGFCKGGVNIHYLE 444 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 739 Number of extensions: 33 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 737 Length of database: 452 Length adjustment: 36 Effective length of query: 701 Effective length of database: 416 Effective search space: 291616 Effective search space used: 291616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory