Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate PfGW456L13_3427 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::F4JML5 (301 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3427 Length = 272 Score = 164 bits (416), Expect = 2e-45 Identities = 96/245 (39%), Positives = 145/245 (59%), Gaps = 3/245 (1%) Query: 58 VNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLKERRTMSP 117 V L RP NAIN E+ + + A + QD RV++IR FCAGAD+KERR Sbjct: 28 VVLTRPRQINAINDEIRQGVPQALALLQQDPDIRVIVIRGEGDRGFCAGADIKERRGPES 87 Query: 118 S-EVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGENAVFGLPET 176 S +V + ++R++ + ++ ++ P IAAI G +GGGLE+ LACD+R +AVF LPET Sbjct: 88 SLQVRQRMENVRWIET-LDGITKPVIAAIHGYCMGGGLELVLACDIRFAAPDAVFALPET 146 Query: 177 GLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVN-ICVTAGEAHEKAIE 235 GL +IPG GGTQRLSR+V + +++ TG ++ A +A GLV+ + + ++ Sbjct: 147 GLGLIPGGGGTQRLSRVVAPGQALDMLLTGDRVGAEQAQRIGLVSRLASDSANLVQEVRA 206 Query: 236 MAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAFAEKRK 295 AQ+I K P A K+A +E ++ GL++E + L T+D E AF+E+R+ Sbjct: 207 FAQRIASKPPTASAFVKQAARAALEMDLKRGLDLELDLFALLAPTKDAREAAQAFSERRE 266 Query: 296 PLYTG 300 P +TG Sbjct: 267 PRFTG 271 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 272 Length adjustment: 26 Effective length of query: 275 Effective length of database: 246 Effective search space: 67650 Effective search space used: 67650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory