GapMind for catabolism of small carbon sources


Aligments for a candidate for glk in Pseudomonas fluorescens GW456-L13

Align Glucokinase (EC (characterized)
to candidate PfGW456L13_1890 Glucokinase (EC

Query= reanno::WCS417:GFF4431
         (318 letters)

>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1890 Glucokinase
          Length = 319

 Score =  566 bits (1459), Expect = e-166
 Identities = 274/316 (86%), Positives = 296/316 (93%)







Lambda     K      H
   0.320    0.139    0.429 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 458
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 318
Length of database: 319
Length adjustment: 27
Effective length of query: 291
Effective length of database: 292
Effective search space:    84972
Effective search space used:    84972
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate PfGW456L13_1890 (Glucokinase (EC
to HMM TIGR00749 (glk: glucokinase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00749.hmm
# target sequence database:        /tmp/gapView.25707.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00749  [M=315]
Accession:   TIGR00749
Description: glk: glucokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
      4e-81  258.7   0.0    4.6e-81  258.5   0.0    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1890  Glucokinase (EC

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1890  Glucokinase (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  258.5   0.0   4.6e-81   4.6e-81       1     315 []       5     310 ..       5     310 .. 0.97

  Alignments for each domain:
  == domain 1  score: 258.5 bits;  conditional E-value: 4.6e-81
                                               TIGR00749   1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpi 55 
                                                             lvgdiGGtnar+al     +++e+v+++ + dfps e+++ +yl+      +  i
                                                             89************..8899**************************9999998.5 PP

                                               TIGR00749  56 .kgcfaiatPiigdfvrltnldWalsieelkqelalaklelindfaavayailal 109
                                                                c+++a+P+ gd  ++tn++W ls +   q+l + +l l+ndf+a+a++++ l
                                                             499**************************************************** PP

                                               TIGR00749 110 keedliqlggakveesaaiailGaGtGlGvatliqqsdgrykvlageGghvdfaP 164
                                                             +  ++ ++    +e+  +  ++G+GtGlGv tl++ + gr+ +l+geGghvd+  
                                                             ******************************************************* PP

                                               TIGR00749 165 rseleillleylrkkygrvsaervlsGsGlvliyealskrkgerevsklskeelk 219
                                                              s+ e++l++ + +++g+vsae  lsG Gl  +y+a+   +g+  v  l     +
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1890 167 SSPRETQLWQHIFNEIGHVSAETALSGGGLPRVYRAICAVDGHTPV--L----DT 215
                                                             ****************************************966544..3....58 PP

                                               TIGR00749 220 ekdiseaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfi 274
                                                             ++ i+ a l+g+ ++a + le f+  lG++agn  l+ g rGGvy++GG++Prf 
                                                             99********96.78999************************************* PP

                                               TIGR00749 275 ellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315
                                                             +++ +s+f   f dkG + ++++ iPv +v     Gl+Gag
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1890 270 DFFLESGFARCFADKGCMSDYFKGIPVWLVTAPYSGLMGAG 310
                                                             ***************************************97 PP

Internal pipeline statistics summary:
Query model(s):                            1  (315 nodes)
Target sequences:                          1  (319 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 8.28

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory