Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate PfGW456L13_1569 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1569 Length = 372 Score = 239 bits (609), Expect = 1e-67 Identities = 141/362 (38%), Positives = 202/362 (55%), Gaps = 21/362 (5%) Query: 4 VLLEHIYKTY--PGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGN 61 V + + K Y P +K +LDI+D EF +GPSGCGKTT LRMIAG E TEG Sbjct: 12 VSIRSVRKVYGDPKTGPVALKSIDLDIRDNEFFTLLGPSGCGKTTLLRMIAGFEFPTEGE 71 Query: 62 LYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKL----RKVPKAEIDRRVQ 117 + + + D PP R + VFQ+YAL+PHMT+ +N+AFGL+ + + K ++ RV+ Sbjct: 72 ILLYGENIADRPPFQRPVNTVFQHYALFPHMTIAENLAFGLESHPMGKVLHKTQLAERVR 131 Query: 118 EAAKILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAE 177 E ++ + +RKP LSGGQ+QRVAL RA+ P+V L+DEPLS LD KLR MR E Sbjct: 132 EMLALVQMERFANRKPAQLSGGQQQRVALARALAPHPKVLLLDEPLSALDLKLRQAMREE 191 Query: 178 IRKLHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIG 237 ++ + R T I+VTHDQ EA+TM DRI V+ +G +QQ P+ +Y +P+N FVA FIG Sbjct: 192 LKTIQARTGITFIFVTHDQEEALTMSDRIAVLSEGEVQQVGRPEDIYERPRNRFVADFIG 251 Query: 238 SPAMNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEE 297 NFI G + + D + A LP ++ +G V L VRPE LH Sbjct: 252 E--TNFIEGTVTRVEDGLAWFAGPAGHPLPAQPCSDVR----VGANVTLSVRPERLH--- 302 Query: 298 VFMTTYPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHV-----YHVGSSVKLA 352 + ++ L ++E ++G+++ S+ + + P V + VGS L Sbjct: 303 -LVPATTENALPCRIEAQIYLGTDLQYQVSLSDGSRLTVRTPNCVDQSKRFAVGSQAGLL 361 Query: 353 ID 354 D Sbjct: 362 FD 363 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 372 Length adjustment: 30 Effective length of query: 354 Effective length of database: 342 Effective search space: 121068 Effective search space used: 121068 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory