Align MalK, component of Maltose and maltooligosaccharide porter (characterized)
to candidate PfGW456L13_5058 Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)
Query= TCDB::Q97UG5 (617 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5058 Length = 326 Score = 190 bits (482), Expect = 9e-53 Identities = 103/259 (39%), Positives = 165/259 (63%), Gaps = 5/259 (1%) Query: 355 VVMKILNLSKIYYIRKNLILSEP-INAVNDVSFELKKGTITALVGGSGHGKSTIAKILAG 413 VV+ +L++ Y + + L + A+N VSFEL+ G A+VG SG GKST+A+ L Sbjct: 3 VVLTARDLTRHYEVSRGLFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARALTL 62 Query: 414 MIQQTSGKIILLGKDVSEYGVRNSMWYKENVQMIFQDPYSSLDPRHTVRWHVERPLLIHK 473 + + +SG + + G++V+ +++VQM+FQ PY+SL+PR V + PLLI+ Sbjct: 63 IEEPSSGSLKIAGQEVAGADKAQRKQLRKDVQMVFQSPYASLNPRQKVGDQLAEPLLINT 122 Query: 474 KVSNKDQLLPKIIEVLKNVGLKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADE 533 +S ++ K+ ++K VGL+P ++ +YPH SGG+RQR+A+ARA ++PKVLVADE Sbjct: 123 NLSAAER-REKVQAMMKQVGLRP--EHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADE 179 Query: 534 PVSMLDASLRAGILNLIKKFKKN-GISILYITHDIATVNYIADEIMVIYKGRIVEKGNTY 592 P S LD S++A +LNL ++ + ++I+H++A V ++AD +MV+Y GR VE G Sbjct: 180 PTSALDVSIQAQVLNLFMDLQQEFNTAYVFISHNLAVVRHVADHVMVMYLGRPVEMGTKE 239 Query: 593 EVISNPSHEYTKRLIEAVP 611 ++ S P H YT+ L+ A P Sbjct: 240 DIYSRPLHPYTQALLSATP 258 Score = 182 bits (462), Expect = 2e-50 Identities = 104/308 (33%), Positives = 178/308 (57%), Gaps = 9/308 (2%) Query: 13 ELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYGLLKYPGVVLRGH 72 E++ G F V + V+FE+ + A+ GESGCGKSTLA A+ L++ P G Sbjct: 15 EVSRGLFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARALT-LIEEPS---SGS 70 Query: 73 VYLKDKDILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRAA-VSHGVNVEEA 131 + + +++ + + ++LR K+ V Q +L+P K+GDQ+ ++ ++ E Sbjct: 71 LKIAGQEVAGADKAQRKQLR-KDVQMVFQSPYASLNPRQKVGDQLAEPLLINTNLSAAER 129 Query: 132 RKLIKEKLELVDLPYNVVNMYPHELSGGMRQRVVIATSILLNPSLIILDEPTTGLDVIVQ 191 R+ ++ ++ V L YPH SGG RQR+ +A +++L P +++ DEPT+ LDV +Q Sbjct: 130 REKVQAMMKQVGLRPEHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADEPTSALDVSIQ 189 Query: 192 YEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSKEEIIKRPSHPY 251 ++L +Q++ + V ISH+++++ ++D V +MY G VE+G+KE+I RP HPY Sbjct: 190 AQVLNLFMDLQQEFNTAYVFISHNLAVVRHVADHVMVMYLGRPVEMGTKEDIYSRPLHPY 249 Query: 252 TYLLISSLPSLVKRREK-LLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKCSTLNPALGDI 310 T L+S+ P++ +K + I G P L+ P+ C F+ RCP+ E+CST PAL + Sbjct: 250 TQALLSATPAIHPDPDKPKIKIVGELPNPLNP-PSGCAFHKRCPYATERCSTEEPAL-RL 307 Query: 311 MDGHKARC 318 + G + C Sbjct: 308 IAGRQVAC 315 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 617 Length of database: 326 Length adjustment: 33 Effective length of query: 584 Effective length of database: 293 Effective search space: 171112 Effective search space used: 171112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory