GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mt2d in Pseudomonas fluorescens GW456-L13

Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate PfGW456L13_3038 Multiple polyol-specific dehydrogenase (EC 1.1.1.-)

Query= BRENDA::O08355
         (493 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3038 Multiple
           polyol-specific dehydrogenase (EC 1.1.1.-)
          Length = 490

 Score =  844 bits (2181), Expect = 0.0
 Identities = 414/489 (84%), Positives = 443/489 (90%)

Query: 1   MKLNKQNLTQLAPEVKLPAYTLADTRQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWSI 60
           MKLN+ NL +LAPEV LPAY L +TRQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDW+I
Sbjct: 1   MKLNQLNLNRLAPEVVLPAYALGETRQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWAI 60

Query: 61  CGVGLRSEDRKARDDLAGQDYLFTLYELGDTDDTEVRVIGSISDMLLAEDSAQALIDKLA 120
           CGVGLR+EDR+ARDDL  QDYLFTL+ELGD+ DTEVRVIG++ DMLLAEDSAQALIDKLA
Sbjct: 61  CGVGLRAEDRRARDDLKDQDYLFTLFELGDSGDTEVRVIGALRDMLLAEDSAQALIDKLA 120

Query: 121 SPEIRIVSLTITEGGYCIDDSNGEFMAHLPQIQHDLAHPSSPKTVFGFICAALTQRRAAG 180
           SPEIRIVSLTITEGGYCIDDS GEFMAHLPQIQHDLAHP +PKTVFGF+CAAL +RRAAG
Sbjct: 121 SPEIRIVSLTITEGGYCIDDSTGEFMAHLPQIQHDLAHPGAPKTVFGFLCAALAKRRAAG 180

Query: 181 IPAFTVMSCDNLPHNGAVTRKALLAFAALHNAELHDWIKAHVSFPNAMVDRITPMTSTAH 240
             AFT+MSCDNLPHNGAVTRKALLAFAALH+++L DWI  +VSFPNAMVDRITPMTST H
Sbjct: 181 TAAFTLMSCDNLPHNGAVTRKALLAFAALHDSQLRDWIDTNVSFPNAMVDRITPMTSTLH 240

Query: 241 RLQLHDEHGIDDAWPVVCEPFVQWVLEDKFVNGRPAWEKVGVQFTDDVTPYEEMKIGLLN 300
           RLQL D HG+DDAWPVVCEPF QWVLED+FVNGRPAWEKVGVQFTDDVTPYEEMKI LLN
Sbjct: 241 RLQLADRHGVDDAWPVVCEPFAQWVLEDRFVNGRPAWEKVGVQFTDDVTPYEEMKIKLLN 300

Query: 301 GSHLALTYLGFLKGYRFVHETMNDPLFVAYMRAYMDLDVTPNLAPVPGIDLTDYKQTLVD 360
           GSHLALTYLGFLKGYRFVHE MNDPLFV YMRAYMDLDVTP L  VPGIDL +YK TLV 
Sbjct: 301 GSHLALTYLGFLKGYRFVHEAMNDPLFVRYMRAYMDLDVTPQLPAVPGIDLAEYKNTLVA 360

Query: 361 RFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADGRETERAALVVAAWALYLKGVDEN 420
           RFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADG +T RAALVVAAWALYLKGVDE 
Sbjct: 361 RFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADGCDTRRAALVVAAWALYLKGVDEQ 420

Query: 421 GVSYTIPDPRAEFCQGLVSDDALISQRLLAVEEIFGTAIPNSPEFVAAFERCYGSLRDNG 480
           G +YTI DPRA FCQ LV+DD LI+QRLLAVEEIFGTAI  SPEFVAAFE C  SLR+ G
Sbjct: 421 GETYTIADPRAAFCQALVADDVLITQRLLAVEEIFGTAIARSPEFVAAFEWCCNSLREVG 480

Query: 481 VTTTLKHLL 489
           V+ TL+ +L
Sbjct: 481 VSRTLERVL 489


Lambda     K      H
   0.321    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 938
Number of extensions: 27
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 493
Length of database: 490
Length adjustment: 34
Effective length of query: 459
Effective length of database: 456
Effective search space:   209304
Effective search space used:   209304
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory