Align fructokinase; EC 2.7.1.4 (characterized)
to candidate PfGW456L13_2950 2-ketogluconate kinase (EC 2.7.1.13)
Query= CharProtDB::CH_006622 (307 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2950 Length = 328 Score = 112 bits (280), Expect = 1e-29 Identities = 87/288 (30%), Positives = 135/288 (46%), Gaps = 21/288 (7%) Query: 29 GAPANVAVGVARLGGNSGFIGAVGGDPFGRYMRHTLQQEQVDVSHMYLDDQHRTSTVVVD 88 GA +NVA+G++RLG N ++ VG D GR++ TL++E +D H+ +D H T + Sbjct: 36 GADSNVAIGLSRLGFNVAWLSRVGADSLGRFVIDTLEKEGLDCRHVDIDPAHPTGFQLKS 95 Query: 89 -LDDQGERTFTFMVRPSADLFLVEEDL-PQFAAGQWLHVCSI-ALSAEPSRSTTFAAMES 145 DD + + R SA L + P + LH I A +E +R +F M Sbjct: 96 RTDDGSDPVVEYFRRGSAASHLSSHSIVPDLLKARHLHATGIPAALSETARQMSFELMTR 155 Query: 146 IRSAGGRVSFDPNIRPDLWQDQALLLACLDRALHMANVVKLSEEELVFISSSNDLAYGIA 205 +R AG VSFDPN+RP LW + L++ ++R +A+ V E ++ D A IA Sbjct: 156 MRDAGRSVSFDPNLRPSLWASERLMITEINRLAALAHWVLPGLSEGRLLTGFEDPA-DIA 214 Query: 206 SVTERYQPELLLVTRGKAGVLAAFQQKFTHFNARPVAS------VDTTGAGDAFVAGLLA 259 + E + + G G TH + VA VDT GAGD F G+++ Sbjct: 215 AFYLDQGAEAVAIKLGPHGAYYR-----THLDQGFVAGVPVQTVVDTVGAGDGFAVGMIS 269 Query: 260 SLAANGMPTDMTALEPTLTLAQTCGALATTAKGAMTALPYQRDLNRQF 307 +L N D + A G+ A ++G M LP + ++ +F Sbjct: 270 ALLENHSFAD------AVRRANWIGSRAVQSRGDMEGLPTRSEMVSEF 311 Lambda K H 0.320 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 328 Length adjustment: 27 Effective length of query: 280 Effective length of database: 301 Effective search space: 84280 Effective search space used: 84280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory