GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS03640 in Pseudomonas fluorescens GW456-L13

Align Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale)
to candidate PfGW456L13_3911 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

Query= uniprot:D8IZC7
         (521 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3911 Ribose ABC
           transport system, ATP-binding protein RbsA (TC
           3.A.1.2.1)
          Length = 517

 Score =  326 bits (836), Expect = 1e-93
 Identities = 202/516 (39%), Positives = 294/516 (56%), Gaps = 13/516 (2%)

Query: 6   LLQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVHAPDQGEILL 65
           +L + GI K++ A   L+ + LT+  GE+ AL GENGAGKSTL K++ G+  P  G++  
Sbjct: 9   VLSVSGIGKTY-AQPVLAGIDLTLMRGEVLALTGENGAGKSTLSKIIGGLVTPTTGQMQY 67

Query: 66  DGRPVALRDPGASRAAGINLIYQELAVAPNISVAANVFMGSELRTRLGLIDHAAMRSRTD 125
            G+         + A GI ++ QEL + P +SVA N+F+ + L ++ G I    +R    
Sbjct: 68  QGQDYRPGSRAQAEALGIRMVMQELNLLPTLSVAENLFLDN-LPSKGGWISRKQLRKAAI 126

Query: 126 AVLRQLGA-GFGASDLAGRLSIAEQQQVEIARALVHRSRIVIMDEPTAALSERETEQLFN 184
             +  +G        L G L I  QQ VEIAR L+    ++I+DEPTA L+ RE E LF 
Sbjct: 127 EAMAHVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVEMLFE 186

Query: 185 VVRRLRDEGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIVQMMVGRSL 244
            + RL+  G++IIYISHR+ E+  +A R+ VLRDG+ V        +SE++V +MVGR L
Sbjct: 187 QITRLQSRGVSIIYISHRLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVTLMVGREL 246

Query: 245 SEFYQHQRIAPADAAQLPTVMQVRALA-GGKIRPASFDVRAGEVLGFAGLVGAGRTELAR 303
            E         A     P V+ V  L+   K+R  SF+VRAGE+ G +GL+GAGRTEL R
Sbjct: 247 GEHID----MGARKIGAP-VLTVNGLSRSDKVRDVSFEVRAGEIFGISGLIGAGRTELLR 301

Query: 304 LLFGADPRSGGDILLEGRP---VHIDQPRAAMRAGIAYVPEDRKGQGLFLQMAVAANATM 360
           L+FGAD    G I L G P   +++  P  A+  GIA + EDRKG+GL L  ++ AN  +
Sbjct: 302 LIFGADIADSGTIAL-GAPAQVINVRSPVDAVGHGIALITEDRKGEGLLLTQSIGANIAL 360

Query: 361 NVASRHTRLGLVRSRSLGGVARAAIQRLNVKVAHPETPVGKLSGGNQQKVLLARWLEIAP 420
                 +  G V +     +A+  I  + ++ + P   V +LSGGNQQKV++ RWLE   
Sbjct: 361 GNMPGISGAGFVDNDKERALAQRQIDAMRIRSSGPAQLVSELSGGNQQKVVIGRWLERDC 420

Query: 421 KVLILDEPTRGVDIYAKSEIYQLVHRLASQGVAVVVISSELPEVIGICDRVLVMREGMIT 480
            VL+ DEPTRG+D+ AK +IY L+  L  QG A+VV+SS+L E++ ICDR+ V+  G + 
Sbjct: 421 SVLLFDEPTRGIDVGAKFDIYNLLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGSLI 480

Query: 481 GELAGAAITQENIMRLATDTNVPRTAPASHSSPTPL 516
                 + TQ+ ++  A      R A    ++P  L
Sbjct: 481 DTFDRDSWTQDELLAAAFAGYQKRDAQLVEAAPRDL 516


Lambda     K      H
   0.320    0.135    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 706
Number of extensions: 34
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 521
Length of database: 517
Length adjustment: 35
Effective length of query: 486
Effective length of database: 482
Effective search space:   234252
Effective search space used:   234252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory