GapMind for catabolism of small carbon sources

 

Aligments for a candidate for TM1749 in Pseudomonas fluorescens GW456-L13

Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate PfGW456L13_2876 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)

Query= TCDB::Q9X271
         (324 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2876 Oligopeptide
           transport system permease protein OppB (TC 3.A.1.5.1)
          Length = 525

 Score =  211 bits (538), Expect = 2e-59
 Identities = 114/260 (43%), Positives = 166/260 (63%), Gaps = 4/260 (1%)

Query: 1   MMELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINR 60
           M  L+ + +L V F         V  +   +  GE L +VGESGSGKSV+  S+L+L+ +
Sbjct: 1   MTNLIEIRDLSVAFSGQT----VVRNLCLDIRPGECLALVGESGSGKSVTAHSILQLLPQ 56

Query: 61  NGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWH 120
                 G   + G++L+  +  +LR +RG  I++IFQ PMTSLNP+  +  Q+ E ++ H
Sbjct: 57  TDTETTGSIRYRGQELVGADAGKLRKLRGNRIAMIFQEPMTSLNPLHSIEKQIGETLLVH 116

Query: 121 RLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADE 180
           + +  + A+ R +ELL  VGI +  +R   YP Q SGG RQRVMIAMALAC P+LLIADE
Sbjct: 117 KGLAGKAAQARILELLHLVGIQKPEERLKAYPHQLSGGQRQRVMIAMALACEPELLIADE 176

Query: 181 PTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVE 240
           PTTALDVT+Q +I+ LL+ L++  GMS++ I+HDL++  +   R+  M AG+IVE+AP E
Sbjct: 177 PTTALDVTVQRKILLLLKSLQQRLGMSLLLISHDLNLVRSIAQRVCVMKAGEIVEQAPCE 236

Query: 241 EILKTPLHPYTKGLLNSTLE 260
            +   P HPY+  LL++  E
Sbjct: 237 TLFTEPRHPYSCILLHAEPE 256



 Score =  183 bits (464), Expect = 9e-51
 Identities = 108/263 (41%), Positives = 161/263 (61%), Gaps = 16/263 (6%)

Query: 4   LLNVNNLKVEFHRVEGI------VKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRL 57
           +L V+NL+V F    G+      ++AVDGIS  + +G++LGIVGESGSGKS    ++LRL
Sbjct: 268 VLEVDNLQVRFPVGGGLFQRKTWLRAVDGISLNIQRGKTLGIVGESGSGKSTLGQAILRL 327

Query: 58  INRNGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPI 117
           ++  G I      F G+ L  L +++LR  R K + ++FQ+P  SL+P + V   + E +
Sbjct: 328 LDSEGGIR-----FQGQALDGLTQKQLRPWR-KKMQVVFQDPFGSLSPRMSVAQIISEGL 381

Query: 118 IWHRLMKNEEARERAIELLERVGI-PESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLL 176
             H  +  EE     I  L  VG+ P+S  R   YP +FSGG RQR+ IA AL   P L+
Sbjct: 382 EVHSQLSTEECNAEVIRALNEVGLDPQSRHR---YPHEFSGGQRQRIAIARALVLKPALI 438

Query: 177 IADEPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEE 236
           + DEPT+ALD T+Q Q++ LL++L+E+YG++ +FI+HDL+V       +I +  GK+VE 
Sbjct: 439 LLDEPTSALDRTVQKQVVALLRQLQEKYGLTYLFISHDLAVVRALAHDMIVIKDGKVVER 498

Query: 237 APVEEILKTPLHPYTKGLLNSTL 259
               E+  +P HPYTK LL + +
Sbjct: 499 GASHEVFDSPQHPYTKELLAAAM 521


Lambda     K      H
   0.320    0.139    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 404
Number of extensions: 14
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 324
Length of database: 525
Length adjustment: 31
Effective length of query: 293
Effective length of database: 494
Effective search space:   144742
Effective search space used:   144742
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory