Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate PfGW456L13_5057 Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5057 Length = 322 Score = 272 bits (695), Expect = 9e-78 Identities = 145/304 (47%), Positives = 192/304 (63%), Gaps = 1/304 (0%) Query: 2 MELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRN 61 M LL + NL V F + VDG+ +++KGE L IVGESGSGKSV++++L+ LI Sbjct: 1 MSLLEIKNLNVRFGD-KNATPVVDGLDLQVDKGEVLAIVGESGSGKSVTMMALMGLIEHP 59 Query: 62 GRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHR 121 G + F GK++LKLN + R I GKD+S++FQ+PMT+LNP VG Q+ E + H Sbjct: 60 GIVTADALNFDGKNMLKLNNRQRRQIVGKDLSMVFQDPMTALNPSYTVGFQIEEVLRLHL 119 Query: 122 LMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEP 181 M + AR+RAIELLE+V IP + R YP Q SGGM QRV IAMA+A PKLLIADEP Sbjct: 120 KMSGKAARKRAIELLEKVEIPGAASRMDAYPHQLSGGMSQRVAIAMAIAGEPKLLIADEP 179 Query: 182 TTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEE 241 TTALDVTIQAQIM+LL L++E M ++ ITHDL+V R+ MYAG+ VE V + Sbjct: 180 TTALDVTIQAQIMDLLLALQKEQNMGLVLITHDLAVVAETAQRVCVMYAGQAVEVGQVPQ 239 Query: 242 ILKTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQRE 301 + P HPY++ LL + E +L +PG P P GC PRC + + C+++ Sbjct: 240 LFDIPAHPYSEALLKAIPEHSLGASRLSTLPGIVPGRYDRPQGCLLSPRCPYVKDNCRQQ 299 Query: 302 EPPL 305 P L Sbjct: 300 RPAL 303 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 322 Length adjustment: 28 Effective length of query: 296 Effective length of database: 294 Effective search space: 87024 Effective search space used: 87024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory