Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate PfGW456L13_2876 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2876 Length = 525 Score = 236 bits (601), Expect = 1e-66 Identities = 122/251 (48%), Positives = 178/251 (70%), Gaps = 7/251 (2%) Query: 13 LLQTVDLKKYFPQG------KRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKL 66 +L+ +L+ FP G K L+AVDGIS+ I+ G+TLG+VGESG GKSTLG+ IL+L Sbjct: 268 VLEVDNLQVRFPVGGGLFQRKTWLRAVDGISLNIQRGKTLGIVGESGSGKSTLGQAILRL 327 Query: 67 LRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKI 126 L +GG I F+G+ + L K+++P+RKKMQ++FQDP GSL+P+M+V +II + L +H Sbjct: 328 LDSEGG-IRFQGQALDGLTQKQLRPWRKKMQVVFQDPFGSLSPRMSVAQIISEGLEVHSQ 386 Query: 127 GTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSA 186 + +E V L+ VG+ + + +PHEFSGGQ+QRI IARAL L P I+ DEP SA Sbjct: 387 LSTEECNAEVIRALNEVGLDPQSRHRYPHEFSGGQRQRIAIARALVLKPALILLDEPTSA 446 Query: 187 LDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFL 246 LD ++Q Q++ LL ++Q+K G++YLFI+H+LAVV ++H + V+ GK+VE G ++F Sbjct: 447 LDRTVQKQVVALLRQLQEKYGLTYLFISHDLAVVRALAHDMIVIKDGKVVERGASHEVFD 506 Query: 247 NPIHPYTRALL 257 +P HPYT+ LL Sbjct: 507 SPQHPYTKELL 517 Score = 173 bits (438), Expect = 1e-47 Identities = 98/260 (37%), Positives = 163/260 (62%), Gaps = 11/260 (4%) Query: 10 MKPLLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRP 69 M L++ DL F G+ +++ + ++I+ GE L LVGESG GKS +IL+LL Sbjct: 1 MTNLIEIRDLSVAF-SGQTVVR---NLCLDIRPGECLALVGESGSGKSVTAHSILQLLPQ 56 Query: 70 DG----GKIFFEGKDITNLNDKEMKPYR-KKMQIIFQDPLGSLNPQMTVGRIIEDPLIIH 124 G I + G+++ + +++ R ++ +IFQ+P+ SLNP ++ + I + L++H Sbjct: 57 TDTETTGSIRYRGQELVGADAGKLRKLRGNRIAMIFQEPMTSLNPLHSIEKQIGETLLVH 116 Query: 125 KIGTKKERRKRVEELLDMVGIGR--EFINSFPHEFSGGQQQRIGIARALALNPKFIVCDE 182 K K + R+ ELL +VGI + E + ++PH+ SGGQ+QR+ IA ALA P+ ++ DE Sbjct: 117 KGLAGKAAQARILELLHLVGIQKPEERLKAYPHQLSGGQRQRVMIAMALACEPELLIADE 176 Query: 183 PVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVD 242 P +ALDV++Q +I+ LL+ +QQ++G+S L I+H+L +V I+ +V VM G+IVE + Sbjct: 177 PTTALDVTVQRKILLLLKSLQQRLGMSLLLISHDLNLVRSIAQRVCVMKAGEIVEQAPCE 236 Query: 243 KIFLNPIHPYTRALLKSVPK 262 +F P HPY+ LL + P+ Sbjct: 237 TLFTEPRHPYSCILLHAEPE 256 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 328 Length of database: 525 Length adjustment: 31 Effective length of query: 297 Effective length of database: 494 Effective search space: 146718 Effective search space used: 146718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory