GapMind for catabolism of small carbon sources

 

Aligments for a candidate for man-isomerase in Pseudomonas fluorescens GW456-L13

Align D-mannose isomerase (EC 5.3.1.7) (characterized)
to candidate PfGW456L13_1893 N-acylglucosamine 2-epimerase (EC 5.1.3.8)

Query= reanno::WCS417:GFF4325
         (419 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1893
           N-acylglucosamine 2-epimerase (EC 5.1.3.8)
          Length = 419

 Score =  635 bits (1637), Expect = 0.0
 Identities = 300/402 (74%), Positives = 335/402 (83%)

Query: 9   SSWLNAPAHYVWLAAEGQRLLAFAKASRLPDGFGNLDDKGQLPADAHAETMNTARMTHSF 68
           SSWLNAPAH  WLA EG RLL FAKAS+LP+GFGNLD+KG+LP+DA A+TMNTARMTHSF
Sbjct: 9   SSWLNAPAHQQWLATEGLRLLTFAKASKLPEGFGNLDEKGRLPSDAQAQTMNTARMTHSF 68

Query: 69  AMAHALGLPGYAELVAHGVAALSGALRDSEHGGWFAAPHALDGNRGKAAYLHAFVALAAS 128
           AMAH  GLPG+AELV HGVAAL G LRD+ +GGWFA     DGN GK AYLHAFVALAAS
Sbjct: 69  AMAHIQGLPGFAELVDHGVAALRGPLRDTLYGGWFATAEHRDGNTGKNAYLHAFVALAAS 128

Query: 129 SAVVAGAPGASTLLNDAIHIIDHFFWSEEEGVMLESFAQDWSGVEAYRGANSNMHATEAF 188
           SAVVA  PGA  LL+DAI IID +FWSEEEG M ESF +DWS  EAYRGANSNMHATEAF
Sbjct: 129 SAVVAQRPGAQALLDDAIDIIDTYFWSEEEGAMRESFNRDWSEEEAYRGANSNMHATEAF 188

Query: 189 LALADVTGDTRWLDRALRIVERVIHTHAAGNQFMVIEHFDTHWHPLLGYNEDNPADGFRP 248
           LALADVT D RWL RA RIVERVIH HAA N ++VIEHFD  W PL  YN DNPADGFRP
Sbjct: 189 LALADVTDDNRWLSRAHRIVERVIHGHAAANDYLVIEHFDRAWQPLRDYNRDNPADGFRP 248

Query: 249 YGITPGHGFEWARLVLHLEAARLQAGLVTPEWLVADAKRLFASACEYAWSVDGAPGIVYT 308
           YG TPGHGFEWARL+LHLEA+R++AG++TP WLV DA++LF   C + W VDGAPGIVYT
Sbjct: 249 YGTTPGHGFEWARLLLHLEASRVKAGMLTPGWLVTDAQKLFEHNCFHGWDVDGAPGIVYT 308

Query: 309 LDWNHRPVVRERLHWTHAEASAAAQALLKRTGELHYETWYRRFWEFCETHFIDRLHGSWH 368
           LDW+++ VVR RLHWTH EASAAA ALLKRTG+  YE WYR FWEFC++HFIDR  GSWH
Sbjct: 309 LDWDNKAVVRHRLHWTHCEASAAASALLKRTGDEQYEHWYRLFWEFCDSHFIDREDGSWH 368

Query: 369 HELSPHNQPSSNIWGGKPDLYHAWQAVLLPALPLAPSMASAI 410
           HEL P N+PS++IW GKPDLYHAWQAVL+P L LAPSMA+A+
Sbjct: 369 HELDPQNRPSADIWPGKPDLYHAWQAVLIPRLALAPSMATAL 410


Lambda     K      H
   0.321    0.134    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 803
Number of extensions: 34
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 419
Length of database: 419
Length adjustment: 32
Effective length of query: 387
Effective length of database: 387
Effective search space:   149769
Effective search space used:   149769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory