GapMind for catabolism of small carbon sources

 

Aligments for a candidate for H281DRAFT_04042 in Pseudomonas fluorescens GW456-L13

Align Aromatic amino acid transporter AroP (characterized, see rationale)
to candidate PfGW456L13_4291 Aromatic amino acid transport protein AroP

Query= uniprot:A0A2Z5MFR8
         (461 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4291 Aromatic
           amino acid transport protein AroP
          Length = 467

 Score =  634 bits (1636), Expect = 0.0
 Identities = 314/467 (67%), Positives = 373/467 (79%), Gaps = 12/467 (2%)

Query: 2   DNALQQDGLKRGLKNRHIQLIALGGAIGTGLFLGSASVLQAAGPSMILGYAIGGVIAFMI 61
           D  L+Q  LKRGLKNRHIQLIALGGAIGTGLFLGSA VL++AGPSMILGYAI G IAF+I
Sbjct: 3   DEILRQGELKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLI 62

Query: 62  MRQLGEMVAQEPVAGSFSHFAYKYWGDFPGFLSGWNYWVLYVLVSMAELTAVGTYVHYWW 121
           MRQLGEM+ +EPVAGSFSHFA+KYWG + GFLSGWNYWVLYVLV MAELTAVG YV +WW
Sbjct: 63  MRQLGEMIVEEPVAGSFSHFAHKYWGGYAGFLSGWNYWVLYVLVGMAELTAVGKYVQFWW 122

Query: 122 PGVPTWVSALVCFAGINAINLANVKAYGETEFWFAIIKVVAVIGMILFGGYLLVSGHGGP 181
           P VP+WVSA V F  +N IN+ NVK +GE EFWFAIIKVVA+IGMI  G Y+L SG GGP
Sbjct: 123 PEVPSWVSAAVFFVLVNLINMMNVKVFGEMEFWFAIIKVVAIIGMIALGCYMLFSGTGGP 182

Query: 182 QASISNLWSHGGFFPHGFHGLFTMLAVIMFSFGGLELIGITAAEADEPQKSIPKAVNQVI 241
           QAS+SNLW HGGFFP+G+ GL   +A IMFSFGGLEL+GITAAEA EP K IPKA+NQV+
Sbjct: 183 QASVSNLWDHGGFFPNGYSGLLMAMAFIMFSFGGLELVGITAAEASEPGKVIPKAINQVV 242

Query: 242 YRILIFYICSLAVLLSLYPWNEV---------AAGGSPFVMIFSQIGSTLTANVLNVVVL 292
           YR+LIFY+ +L VLLSLYPW+++         A GGSPFV IFS IGS   A++LN VVL
Sbjct: 243 YRVLIFYVGALTVLLSLYPWDQLLQTLGASGDAYGGSPFVQIFSLIGSDTAAHILNFVVL 302

Query: 293 TAALSVYNSGVYANSRMLYGLAEQGNAPRALMKVDRRGVPYMAIGLSALATFTCVIVNYL 352
           TAALSVYNSGVY NSRMLYGLAEQG+AP+ALMK++++GVP +A+G+SAL T   V+VNYL
Sbjct: 303 TAALSVYNSGVYCNSRMLYGLAEQGDAPKALMKLNKQGVPLLALGVSALITLLSVLVNYL 362

Query: 353 IPAEALGLLMALVVAALVLNWALISLTHLKSRRAMVAAGETLVFKSFWFPVSNWICLAFM 412
            P EAL LL ALVVA+L++NWA+ISLTHLK R+ M   G    FKSFWFP SN++CLAFM
Sbjct: 363 APHEALELLFALVVASLMINWAMISLTHLKFRKIMSQQGIVPGFKSFWFPFSNYLCLAFM 422

Query: 413 ALILVILAMTPGLSVSVLLVPLWLVVMWAGYAFKRRRAAAHVAARVV 459
            +I+ ++ M PG+  SV  +P+W++++   + F R R A   A  VV
Sbjct: 423 VMIVCVMLMIPGIRASVFAIPVWVLII---FGFYRMRMAKDRALPVV 466


Lambda     K      H
   0.327    0.140    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 667
Number of extensions: 27
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 461
Length of database: 467
Length adjustment: 33
Effective length of query: 428
Effective length of database: 434
Effective search space:   185752
Effective search space used:   185752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory