Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate PfGW456L13_3210 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::Q5SLK3 (254 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3210 Length = 263 Score = 162 bits (409), Expect = 8e-45 Identities = 102/257 (39%), Positives = 136/257 (52%), Gaps = 4/257 (1%) Query: 2 VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQ 61 +L + + GV +TLNR + NA+ L L+ L D VR ++LTG+GR+F AG Sbjct: 7 LLSQVEAGVAWITLNRTAQRNALDIPTLKNLHGLLDAYNADPAVRVVVLTGSGRSFCAGA 66 Query: 62 DLTEFGDRKPDYEAHLRRYNRVVEALS----GLEKPLVVAVNGVAAGAGMSLALWGDLRL 117 DL E+ D + + AL LEKP + A+NG A GAGM L L DLR+ Sbjct: 67 DLDEWADAEARGALETYGWTETAHALMTRLHSLEKPTIAAINGTAVGAGMDLTLCCDLRI 126 Query: 118 AAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVV 177 A A F + + PD+G S+ LPRL+G +A+ LL L A+ AL GLV V Sbjct: 127 AGQSARFKAGYTSMAYSPDAGASWHLPRLIGSEQAKRLLFLDELWGADRALDAGLVGDVC 186 Query: 178 PAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHE 237 ++L+ LA LA GPT A+A TKKL+ E SL E L E G+++D Sbjct: 187 ADDQLLTVTSELAARLAAGPTFAFAQTKKLMREGAERSLAEQLQAELAAGLLCGRSEDGN 246 Query: 238 EGVRAFREKRPPRFQGR 254 E +RA EKRP RF GR Sbjct: 247 EALRAAMEKRPARFIGR 263 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 263 Length adjustment: 24 Effective length of query: 230 Effective length of database: 239 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory