Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate PfGW456L13_2434 Phenylacetate degradation enoyl-CoA hydratase PaaA (EC 4.2.1.17)
Query= uniprot:A0A2Z5MCI7 (262 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2434 Length = 257 Score = 120 bits (301), Expect = 3e-32 Identities = 78/244 (31%), Positives = 127/244 (52%), Gaps = 5/244 (2%) Query: 18 VLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADNFFCAGGNLNRLLENRA 77 ++TL P A NAL ++ L+ + DP RAVV+TG+ F AG ++ + E Sbjct: 16 LITLQRPQALNALTTELLGELAAELNIAQADPDTRAVVLTGSRKAFAAGADIKEMAERDL 75 Query: 78 KDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADDAKFVMS 137 V A W + R S KP+IAAV+G A G G LA+ D+I+A +DA+F Sbjct: 76 ----VGILDDPRQASWQAITRFS-KPLIAAVNGFALGGGCELAMHADIIIAGEDARFGQP 130 Query: 138 YARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKPGTARDAAV 197 +G+ P GG+ L +A+ + +A ++++ G+ I A + +G+V+++T+P + A+ Sbjct: 131 EINLGIMPGAGGTQRLLRAVGKSMAMQMVLTGESIDARQAQRVGLVSEVTQPEFTVERAL 190 Query: 198 AWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREGLEGISAFLEKR 257 A + +P +V K + A L+ L ER F R+ EGI+AF EKR Sbjct: 191 HIAHSIAAKAPLAVRLAKEALLKAMDTDLATGLRFERHAFTVLAGTRDRDEGIAAFQEKR 250 Query: 258 APVY 261 +P + Sbjct: 251 SPTF 254 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 257 Length adjustment: 24 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory