GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ppa in Pseudomonas fluorescens GW456-L13

Align Phenylacetate permease, Ppa (characterized)
to candidate PfGW456L13_2421 Acetate permease ActP (cation/acetate symporter)

Query= TCDB::O50471
         (520 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2421 Acetate
           permease ActP (cation/acetate symporter)
          Length = 548

 Score =  915 bits (2364), Expect = 0.0
 Identities = 463/520 (89%), Positives = 496/520 (95%)

Query: 1   MNWTAISMFMVFVCFTLLVTRWAALRTRSASDFYTAGGGLTGMQNGLAIAGDMISAASFL 60
           +NW AI MF+VFV FTL VTRWAALRTRS SDFYTAGGG+TG QNGLAIAGDMISAASFL
Sbjct: 29  LNWNAIGMFLVFVLFTLGVTRWAALRTRSTSDFYTAGGGMTGFQNGLAIAGDMISAASFL 88

Query: 61  GISAMMFMNGYDGLLYALGVLAGWPIILFLIAERLRNLGKYTFADVVSYRLAQTPVRLTS 120
           GISAMMF+NGYDGLLYALGVLAGWPIILFLIAERLRNLGKYTFADVVSYRL QTPVRLTS
Sbjct: 89  GISAMMFLNGYDGLLYALGVLAGWPIILFLIAERLRNLGKYTFADVVSYRLEQTPVRLTS 148

Query: 121 AFGTLVVALMYLVAQMVGAGKLIELLFGISYLYAVMLVGVLMVAYVTFGGMLATTWVQII 180
           AFGTL VALMYLVAQMVGAGKLIELLFGI YLYAVMLVGVLMV YVTFGGMLATTWVQII
Sbjct: 149 AFGTLTVALMYLVAQMVGAGKLIELLFGIDYLYAVMLVGVLMVFYVTFGGMLATTWVQII 208

Query: 181 KAVMLLSGTSFMAFMVLKHFGFSTEAMFASAVAVHAKGQAIMAPGGLLSNPVDAISLGLG 240
           KAVMLL GTSFMAFMVLKHFGFSTEAMFA A AVHAKG AIMAPGGLLSNP+DAISLGLG
Sbjct: 209 KAVMLLFGTSFMAFMVLKHFGFSTEAMFAGATAVHAKGNAIMAPGGLLSNPIDAISLGLG 268

Query: 241 MMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYLLLIVIGFGAIVMVGTEPSYR 300
           MMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYLLLI++GFGAIVMVGT+P++R
Sbjct: 269 MMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYLLLIIVGFGAIVMVGTDPAFR 328

Query: 301 DATGAIIGGGNMIAVHLAQAVGGNLFLGFISAVAFATILAVVAGLALSGASAVSHDLYAC 360
           DA+GAIIGGGNM+AVHLA AVGGNLFLGFISAVAFATILAVVAGLALSGASAVSHDLYAC
Sbjct: 329 DASGAIIGGGNMVAVHLAHAVGGNLFLGFISAVAFATILAVVAGLALSGASAVSHDLYAC 388

Query: 361 VIRQGKATEQEEMRVSRIATLLIGLLAVLLGLMFESQNIAFLSGLVLAVAASVNFPVLLL 420
           V+R+G+A+EQ+EMRVSRIATL IG+LA++LGL+FESQNIAFLSGLVLA+AASVNFPVL L
Sbjct: 389 VMRKGQASEQQEMRVSRIATLCIGVLAIVLGLLFESQNIAFLSGLVLAIAASVNFPVLFL 448

Query: 421 SMFWKGLTTRGAVCGSMAGLASAVLLVVLGPAVWVNVLHHEKALFPYSNPALFSMSLAFL 480
           SM+WKGLTTRGAV GS++GL SA++L+VL PAVWVNV+HH+KALFPYSNPALFSMSLAF 
Sbjct: 449 SMYWKGLTTRGAVLGSLSGLVSAIVLLVLSPAVWVNVMHHDKALFPYSNPALFSMSLAFF 508

Query: 481 SAWVFSVTDSSERASEERGRYLAQFIRSMTGIGAAGASKH 520
           SAW+FSVTD+S RA+ ERGRYLAQFIRSMTGIGA GASKH
Sbjct: 509 SAWLFSVTDTSPRAALERGRYLAQFIRSMTGIGATGASKH 548


Lambda     K      H
   0.328    0.139    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1075
Number of extensions: 29
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 520
Length of database: 548
Length adjustment: 35
Effective length of query: 485
Effective length of database: 513
Effective search space:   248805
Effective search space used:   248805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory