Align BadH (characterized)
to candidate PfGW456L13_3458 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3458 Length = 251 Score = 142 bits (358), Expect = 7e-39 Identities = 92/256 (35%), Positives = 135/256 (52%), Gaps = 13/256 (5%) Query: 3 RLQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRC 62 +L K ++TGG GIG A + F +EGA + DL + A D GG A + C Sbjct: 2 QLAGKRIIVTGGARGIGAAVVKAFVEEGAHVVSLDLG-----EAASITGDGGGWAHSRVC 56 Query: 63 DIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMH 122 DIAD SVDAA A + L +D+LV+ AG EWE++ A+N G + Sbjct: 57 DIADSQSVDAAFAWASEQLNGLDVLVHAAGIAPNASADSITLDEWEKVFAVNTRGTFLTN 116 Query: 123 HAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNV 182 A +++ GRI+N AS A +G G+A YAA KG ++A+++T+ARE GITVN Sbjct: 117 RAAYE-LLKGSGGRIINFASAAGVLGQPGKAHYAASKGAVLAWTRTVAREWGPLGITVNA 175 Query: 183 VCPGPTDTALLADVTSGAANPEKLIE---AFTKAIPL-GRLGKP-DDLAGAIAFFGSDDA 237 + P + D T + + E+L + +P+ G+LG+P DLA + F D + Sbjct: 176 IAPAMWTP--MYDATRASMSAEQLQQHDAYMAGQVPIGGKLGEPARDLAPVLVFLAGDGS 233 Query: 238 GFITGQVLSVSGGLTM 253 F+TGQ L + GG+ M Sbjct: 234 RFVTGQTLVIDGGMMM 249 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory