Align (S)-3-hydroxybutanoyl-CoA dehydrogeanse (EC 1.1.1.35) (characterized)
to candidate PfGW456L13_3873 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)
Query= metacyc::MONOMER-19851 (285 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3873 Length = 283 Score = 370 bits (951), Expect = e-107 Identities = 187/279 (67%), Positives = 224/279 (80%) Query: 7 SIGVIGAGTMGNGIAQVCAVAGLNVTMLDVDDAALKRGMDTIIRNLDRMVAKEKLTASAR 66 +IGVIGAGTMGNGIAQVCA+AG NVT+LD+ ++AL++ + T+ +NLDR +AKE LT + Sbjct: 5 NIGVIGAGTMGNGIAQVCAMAGFNVTLLDISESALQKAVATVGKNLDRQIAKETLTPEQK 64 Query: 67 DAALAKISTGLDYGALQSADMVIEAATENLGLKLKILRQVANCVGKDAIIATNTSSISIT 126 AAL KI T DY +LQ+A +VIEAATENL LKL++L+Q+A V + +IA+NTSS+SIT Sbjct: 65 QAALDKIRTSTDYSSLQNAQLVIEAATENLDLKLRVLQQIAAQVSSECVIASNTSSLSIT 124 Query: 127 QLGAVLDAPECFIGIHFFNPVPLMSLLEVIRGVQTSDATHAATMAFAQKVGKAPITVRNS 186 QL A + PE FIG+HFFNPVP+M L+EVIRG+QTSDATH + A +GK IT N Sbjct: 125 QLAASVSQPERFIGLHFFNPVPVMGLIEVIRGLQTSDATHQLALDMATTLGKTAITAGNR 184 Query: 187 PGFVVNRILCPMINEAIFVLQEGLASAEGIDVGMRLGCNHPIGPLALADMIGLDTLLSIM 246 PGFVVNRIL PMINEAI V QEGLASAE ID GMRLGCN PIGPLALAD+IGLDTLLSI+ Sbjct: 185 PGFVVNRILVPMINEAILVFQEGLASAEDIDAGMRLGCNQPIGPLALADLIGLDTLLSIL 244 Query: 247 GVLYDEFNDPKYRPALLLKEMVAAGRLGRKTKQGFYSYS 285 YD FND KYRPA LLKEMVAAG LGRKT +GF++Y+ Sbjct: 245 EAFYDGFNDSKYRPAPLLKEMVAAGYLGRKTGRGFHAYA 283 Lambda K H 0.321 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 283 Length adjustment: 26 Effective length of query: 259 Effective length of database: 257 Effective search space: 66563 Effective search space used: 66563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory