Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate PfGW456L13_4590 Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)
Query= uniprot:D8ITH5 (401 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4590 Length = 400 Score = 560 bits (1442), Expect = e-164 Identities = 277/399 (69%), Positives = 334/399 (83%), Gaps = 1/399 (0%) Query: 2 EALICDAIRTPFGRYGGALGAVRADDLAAAPIRSLMERNPGVDWSRVEDILYGCANQAGE 61 + ICDAIRTP GR+GG L VRADDLAA PI++LMERNP VDW+ V+++ GCANQAGE Sbjct: 3 DVYICDAIRTPIGRFGGGLSTVRADDLAAVPIKALMERNPSVDWNAVDEVFLGCANQAGE 62 Query: 62 DNRNVARMAGLLAGLPIAVPGSTVNRLCGSSLDAVGMAARAIKSGEVQLMIAGGVESMTR 121 DNRNVARMA LLAGLP +PG T+NRLC S +DA+G A RAI SGE++L IAGGVESM+R Sbjct: 63 DNRNVARMALLLAGLPETIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESMSR 122 Query: 122 APFVMGKAESAFARSAAIFDTTIGWRFVNPLMKAQYGIDSMPETAENVATDFQINRADQD 181 APFVMGKA++AF+R+ + DTTIGWRF+NPLMKAQYG+D+MP+TA+NVA D++++RADQD Sbjct: 123 APFVMGKADAAFSRNMKLEDTTIGWRFINPLMKAQYGVDAMPQTADNVADDYKVSRADQD 182 Query: 182 AFALRSQQRWAAAQAAGFFAGEIAPLTIPQKKGDPLVVTTDEHPRPDTTLATLAKLKGVV 241 AFALRSQQR AAAQAAGFFA EI + I KKG+ VV+ DEHPR DTTL L KLK V Sbjct: 183 AFALRSQQRTAAAQAAGFFAEEIVEVRIAHKKGE-TVVSQDEHPRADTTLEALTKLKPVN 241 Query: 242 RPDGTVTAGNASGVNDGACALLLASPKAADLYRLKPRARVLGMATAGVAPRIMGFGPAPA 301 PD TVTAGNASGVNDGA AL+LAS +A + L RA+VLGMA+AGVAPR+MG GP PA Sbjct: 242 GPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTARAKVLGMASAGVAPRVMGIGPVPA 301 Query: 302 VRKVLAQVGLTLAQMDVIELNEAFAAQGLAVMRDLGLPDDAAHVNPNGGAIAIGHPLGAS 361 VRK++ ++G+ ++ DVIELNEAFA+QGLAV+R+LG+ DDAA VNPNGGAIA+GHPLG S Sbjct: 302 VRKLIERLGVAVSDFDVIELNEAFASQGLAVLRELGIADDAAQVNPNGGAIALGHPLGMS 361 Query: 362 GARLVTTAINQLERSGGRYALCTMCIGVGQGIALVIERV 400 GARLV TA++QLE++GG+ L TMC+GVGQG+AL IERV Sbjct: 362 GARLVLTALHQLEKTGGKKGLATMCVGVGQGLALAIERV 400 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 562 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 400 Length adjustment: 31 Effective length of query: 370 Effective length of database: 369 Effective search space: 136530 Effective search space used: 136530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory