Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate PfGW456L13_1083 Betaine aldehyde dehydrogenase (EC 1.2.1.8)
Query= BRENDA::P05091 (517 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1083 Length = 490 Score = 391 bits (1004), Expect = e-113 Identities = 207/479 (43%), Positives = 285/479 (59%), Gaps = 7/479 (1%) Query: 38 QIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMD 97 +++I+ + DA S TF +NP+ GEV+ +V KEDV++AV +A ++ W M Sbjct: 8 KLYIDGAYSDASSDATFEAINPANGEVLAKVQRATKEDVERAVVSAEKGQKI---WAAMT 64 Query: 98 ASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYH 157 A R R+L R +++ LAALETLD GK Y + VD+ L YYAG Sbjct: 65 AMERSRILRRAVEILRERNDELAALETLDTGKAYSETRYVDIVTGADVLEYYAGLVPAIE 124 Query: 158 GKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLT 217 G+ IP+ F YTR EP+GV I WN+P+ + WK PALA GN ++ K +E T LT Sbjct: 125 GEQIPLRTTSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLT 184 Query: 218 ALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSS 277 L +A + EAG P GV N++ G G G + H ++KV+FTG T+ G+ + +A SS Sbjct: 185 TLKLAEIYTEAGVPNGVFNVLTGSGREVGTWLTEHPRIEKVSFTGGTDTGKKVMASASSS 244 Query: 278 NLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVE 337 +LK VT+ELGGKSP II DAD+D A + A A F++ GQ C G+R FV + F Sbjct: 245 SLKDVTMELGGKSPLIICDDADLDRAADTAMMANFYSSGQVCTNGTRVFVPAHLKAAFEA 304 Query: 338 RSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAAD---- 393 + R +GNP D T GP V + +LGYI GK+EGA+LLCGG D Sbjct: 305 KIAERVARIRIGNPEDENTNFGPLVSFAHMESVLGYIAKGKEEGARLLCGGERLTDGEFA 364 Query: 394 RGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDL 453 +G F+ PTVF D D MTI +EEIFGPVM IL ++T EEV+ RAN++ +GLAA + TKDL Sbjct: 365 KGAFVAPTVFTDCTDDMTIVREEIFGPVMAILSYETEEEVIRRANDTDFGLAAGIVTKDL 424 Query: 454 DKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKV 512 ++A+ + L+AG W+N + A+ P GGYK SG GRE G L +T +K+V V++ Sbjct: 425 NRAHRVIHQLEAGICWINAWGESDAKMPVGGYKQSGVGRENGISSLNNFTRIKSVQVEL 483 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 490 Length adjustment: 34 Effective length of query: 483 Effective length of database: 456 Effective search space: 220248 Effective search space used: 220248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory