GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pad-dh in Pseudomonas fluorescens GW456-L13

Align phenylacetaldehyde dehydrogenase monomer (EC 1.2.1.39) (characterized)
to candidate PfGW456L13_2690 Aldehyde dehydrogenase (EC 1.2.1.3)

Query= metacyc::MONOMER-15732
         (497 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2690 Aldehyde
           dehydrogenase (EC 1.2.1.3)
          Length = 502

 Score =  516 bits (1330), Expect = e-151
 Identities = 252/489 (51%), Positives = 343/489 (70%), Gaps = 5/489 (1%)

Query: 10  ATRAFLERKLKMRIGADWQDAASGRTLSFRNPATGEVLGEVPAADAEDVDRAVRAARQAF 69
           AT+ FL +  KM IG  W +A+ G+T     P+T  ++  +P    +D+DRAV+AAR  F
Sbjct: 17  ATQTFLGKVQKMFIGGAWVEASDGQTSDVVEPSTEGLITRIPMGTTDDLDRAVQAARAQF 76

Query: 70  DDSPWSRLRPRERQNLLWRLADLMERDARQLAELECLNNGKSAAVAQVMDVQLAIDFLRY 129
           D   W + +P ER+ ++ RLADL+E++A +LA++E ++ GKS A A+ +D+Q  +D LRY
Sbjct: 77  DGGAWRQAKPAERERMMQRLADLIEQNAAELAQIESIDMGKSVAFAKDVDIQGTVDTLRY 136

Query: 130 MAGWATKIEGSTVEASMPLMPNDQFHGFVRREAIGVVGAIVAWNFPLLLACWKLGPALAT 189
            AGWATK+ G TVE S+P      +  + R+EA+GVVGAIV WNFPL    WKLG ALAT
Sbjct: 137 FAGWATKLHGRTVEPSLP----GNYLAYTRKEAVGVVGAIVPWNFPLQTMAWKLGAALAT 192

Query: 190 GCTIVLKPADETPLSVLKLAELVDEAGYPAGVFNVVTGTGLNAGAALSRHPGVDKLTFTG 249
           GCT+V+KPA+ T LS L+ AELV EAG P GV N+VTG G   GAA++ HPG+DKLTFTG
Sbjct: 193 GCTVVVKPAELTSLSALRFAELVQEAGIPDGVINIVTGRGSVVGAAMATHPGIDKLTFTG 252

Query: 250 STEVGKLIGKAAMDNMTRVTLELGGKSPTIVMPDANLQEAAAGAATAIFFNQGQVCCAGS 309
           ST VG+ +G+AA+D+M R+TLELGGKSP IV  DA++  AA   A  +FFN GQVC AG+
Sbjct: 253 STPVGQTVGRAALDDMKRLTLELGGKSPVIVCADADIPAAAQAVANGVFFNSGQVCDAGT 312

Query: 310 RLYVHRKHFDNVVADIAGIANGMKLGNGLDPAVQMGPLISAKQQDRVTGYIELGRELGAT 369
           R Y+H   +D  + ++      +K+  GLDP   +GPL+SA Q+ RVT YIE G+  GA 
Sbjct: 313 RAYIHSSVYDEFLRELITYTRTLKMAPGLDPDCFIGPLVSALQKQRVTEYIETGKAEGAE 372

Query: 370 VACGGEGF-GPGYFVKPTVIVDVDQRHRLVQEEIFGPVLVAMPFDDLDEVIGMANDNPYG 428
           +  GG+   GPG+FV+PT+  +     R+VQEEIFGPVLV  PFDD +E + +AND+PYG
Sbjct: 373 LVYGGQPVDGPGFFVEPTIFANCRNDMRIVQEEIFGPVLVTAPFDDEEEALALANDSPYG 432

Query: 429 LGASIWSNDLAAVHRMIPRIKSGSVWVNCHSALDPALPFGGYKMSGVGREVGAAAIEHYT 488
           L A+++SNDL  VH +IPR+K+GSV+VN H  LDP++PFGGYK SG G+++GA  +++  
Sbjct: 433 LAAALYSNDLGKVHSLIPRLKAGSVYVNAHGTLDPSMPFGGYKQSGFGKDLGAEQLDYLL 492

Query: 489 ELKSVLIKL 497
           E K+V I L
Sbjct: 493 ETKAVWITL 501


Lambda     K      H
   0.320    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 694
Number of extensions: 31
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 497
Length of database: 502
Length adjustment: 34
Effective length of query: 463
Effective length of database: 468
Effective search space:   216684
Effective search space used:   216684
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory