Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate PfGW456L13_4609 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)
Query= uniprot:A0A165KER0 (358 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4609 Length = 418 Score = 270 bits (691), Expect = 4e-77 Identities = 162/355 (45%), Positives = 220/355 (61%), Gaps = 47/355 (13%) Query: 4 TKTNWIIGAVALLVLPLILQSFGNAW-VRIADLALLYVLLALGLNIVVGYAGLLDLGYVA 62 T WII +AL+ L+ FG+ V IA L L+YV+L LGLNIVVG AGLLDLGYV Sbjct: 89 TTQRWII--IALIAGALVWPFFGSRGAVDIATLVLIYVMLGLGLNIVVGLAGLLDLGYVG 146 Query: 63 FYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLK 122 FYAVGAY +AL++ + GL S WI +P+A L+AA FG +LG P L+ Sbjct: 147 FYAVGAYSYALLSHYY--------------GL--SFWICLPIAGLMAATFGFLLGFPVLR 190 Query: 123 LRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRL------ 176 LRGDYLAIVTLGFGEIIR+FL NL LT GP G+ I+ FGL ++ Sbjct: 191 LRGDYLAIVTLGFGEIIRLFLRNL---TGLTGGPNGISNIEKPTFFGLTFERKAAEGLQT 247 Query: 177 --EVFGFDINSVTLYYYLFLVLVVVSV---IICYRLQDSRIGRAWMAIREDEIAAKAMGI 231 E FG + NS+ +L+LV +++++ + RL +GRAW A+REDEIA +A+G+ Sbjct: 248 FHEYFGLEYNSINKVIFLYLVALLLALGALFVINRLLRMPLGRAWEALREDEIACRALGL 307 Query: 232 NTRNMKLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVI 291 N +KL AF +GASF G +G+ F A QG V+PESF+ +ES +I+A+VVLGG+G GVI Sbjct: 308 NPTVIKLSAFTLGASFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGMGSQLGVI 367 Query: 292 LGAVLLSALPEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWP 346 L AV++ LPE++R + + R L+ M+++M+ RP+GL P Sbjct: 368 LAAVVMILLPEMMR--------------EFSEYRMLMFGALMVLMMIWRPQGLLP 408 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 418 Length adjustment: 30 Effective length of query: 328 Effective length of database: 388 Effective search space: 127264 Effective search space used: 127264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory