Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate PfGW456L13_4610 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4610 Length = 255 Score = 129 bits (323), Expect = 7e-35 Identities = 84/256 (32%), Positives = 135/256 (52%), Gaps = 18/256 (7%) Query: 1 MTTNILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRV 60 M+ ILKV+ LS+ +GG+ AV G+ L V E ++V LIG NGAGKTT +TG S Sbjct: 1 MSREILKVENLSMRFGGLLAVNGVALSVKEKQVVALIGPNGAGKTTVFNCLTGFYKPS-- 58 Query: 61 EGHIEYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQI---- 116 G I G+ ++G ++ + + +F M+ ENLL+ + + + Sbjct: 59 GGSILLDGEAIEGLPGHKIALKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFLSGLF 118 Query: 117 -----------AADIDKWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLD 165 A D +++ LKE A + AGTL+ G+Q+ L +AR +M+ P++L+LD Sbjct: 119 KTPSFRKSEREAMDFAEFWLEKVNLKEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLD 178 Query: 166 EPSMGLSPIMVEKIFEVIRNVSAQ-GITILLVEQNAKLALEAAHRGYVMESGLITMQGQA 224 EP+ GL+P E + +I + + +T+LL+E + KL + + V+ G G Sbjct: 179 EPAAGLNPKETEDLKALISMLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLANGTP 238 Query: 225 QQMLDDPRVKAAYLGE 240 +Q+ D+P V AYLGE Sbjct: 239 EQIRDNPEVIKAYLGE 254 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 255 Length adjustment: 24 Effective length of query: 217 Effective length of database: 231 Effective search space: 50127 Effective search space used: 50127 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory