Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate PfGW456L13_3149 L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3149 Length = 282 Score = 199 bits (507), Expect = 6e-56 Identities = 101/265 (38%), Positives = 154/265 (58%) Query: 65 DSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVFALIAWQISGVG 124 DS V ++W++ + VF + + G Q + P V I ALI W+ G+ Sbjct: 11 DSVVDSSLEWLMDNGESVFDTTNTFLKGVYEGVQWCIAYPPYYVIAIAIALIGWRAVGLR 70 Query: 125 MGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPLL 184 + T ++L+ IG W + + TLALVLT+ + +V+ +PLG+ +P +++ P L Sbjct: 71 FAILTGLALLFCDVIGLWPETVSTLALVLTSTVLALVVAIPLGVLAGLAPSFDRVVDPFL 130 Query: 185 DAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSF 244 D +QT P ++YL+P + L G G ++ T I A+PP +RLT LGI P + IE + Sbjct: 131 DLIQTMPPYIYLLPAIALLGYGTATALLATFIVAVPPAMRLTSLGIRMTPKEFIELGDAS 190 Query: 245 GASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMG 304 G + QM FK++LP AMP+IMAGVNQ+LM+A MVVIA ++ GGLG+ + + LD+ Sbjct: 191 GVTGWQMFFKIRLPFAMPSIMAGVNQSLMMAFGMVVIAGIVGSGGLGESIYGAVRTLDIA 250 Query: 305 LATVGGVGIVILAIILDRLTQAVGR 329 + + IVIL +ILDRL Q+ R Sbjct: 251 KSINAAIAIVILTMILDRLAQSAAR 275 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 282 Length adjustment: 27 Effective length of query: 327 Effective length of database: 255 Effective search space: 83385 Effective search space used: 83385 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory